DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31321 and Slc46a1

DIOPT Version :9

Sequence 1:NP_731899.1 Gene:CG31321 / 318681 FlyBaseID:FBgn0051321 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_081016.2 Gene:Slc46a1 / 52466 MGIID:1098733 Length:459 Species:Mus musculus


Alignment Length:417 Identity:88/417 - (21%)
Similarity:152/417 - (36%) Gaps:89/417 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 GGWADRYNKRKPCMIMPIIGEALSFTCQIISSIFFESLPMEFG------AYCEAIVPALFGGLTF 212
            |.|:||.. |:|.:::..:|..|    |.:.|||...|.:..|      |.|     ||.|....
Mouse   105 GAWSDRVG-RRPLLVLASLGLLL----QAVVSIFVVQLELHVGFFVLGRALC-----ALLGDFNG 159

  Fly   213 CLMAIYSYITIATPEEDRVFRFGIFAMFVTGVPFIGQPISGVLFTTLGYTWSFASAIVFQLIAIF 277
            .|.|.::.:...:....|.||..:....:.....:...:.|......||...|..|:...::...
Mouse   160 LLAASFASVADVSSNHSRTFRMALLEACIGVAGTLASLLGGHWLRAQGYANPFWLALALLIVMAL 224

  Fly   278 YIIFFIKEVKTTPTTSTTANEPPPLPTSLPPKQQGADNMAYETTNLDELQGNKNVNFQLTPQMEP 342
            |..|...|         |..||                   ::|.|..|:.::::         .
Mouse   225 YAAFCFGE---------TVKEP-------------------KSTRLFTLRHHRSI---------A 252

  Fly   343 KVEVVPPKRSLLKELFDPTLVLDCIRFPLVKRPNNGRMLLILLLCAYFLTVGPTSGENDYWYRFT 407
            ::.|||                         .|...||.|.|...|.|:.|....|..|....:.
Mouse   253 RLYVVP-------------------------APEKSRMHLALYSLAIFVVVTVHFGAQDILTLYE 292

  Fly   408 LK-KLAWNGNDFSIYLTLSSGAALVGTFIGTAILSKLLKVSDSMIGMLSALSIVCSRVLFAFSSS 471
            |. .|.|:..... |.:.:.....:.:.:|..:|...|  :|:.:..:.....:...|:|||::.
Mouse   293 LSAPLCWDSKLIG-YGSAAQHLPYLTSLLGLRLLQFCL--ADTWVAEIGLAFNILGMVVFAFATI 354

  Fly   472 TASFYVAGVVDMFVSL---RVIAIKTIGSSIVAGDELSKMYSIFGISEPIAQFIFPPIFSEIYKS 533
            |...: .|...:|:||   .||..|.  |.:|:..|...::|.......:|..:...||:.||.:
Mouse   355 TPLMF-TGYGLLFLSLVTTPVIRAKL--SKLVSESEQGALFSAVACVNSLAMLMASGIFNSIYPA 416

  Fly   534 TVDSFPGAIWLFGE-IFYIPNVLVFVV 559
            |::...|..:|.|. :.:||.:|:.|:
Mouse   417 TLNFMKGFPFLLGAGLLFIPAILIGVL 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31321NP_731899.1 MFS 141..>271 CDD:119392 29/122 (24%)
MFS_1 143..>271 CDD:284993 29/122 (24%)
MFS <379..559 CDD:119392 45/184 (24%)
Slc46a1NP_081016.2 MFS 73..443 CDD:119392 87/415 (21%)
MFS_1 94..407 CDD:284993 76/379 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I9497
eggNOG 1 0.900 - - E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D333052at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23507
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.