DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31321 and CG18281

DIOPT Version :9

Sequence 1:NP_731899.1 Gene:CG31321 / 318681 FlyBaseID:FBgn0051321 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_649236.1 Gene:CG18281 / 40274 FlyBaseID:FBgn0037003 Length:542 Species:Drosophila melanogaster


Alignment Length:523 Identity:96/523 - (18%)
Similarity:184/523 - (35%) Gaps:124/523 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 QILAAD--VSGKRAPMAAIFPLIVLLFAGGWADRYNKRKPCMIMPIIGEALSFTCQIISSIFFES 190
            ::|..|  |.|.|    .|...:.....|..:| ::.||..|::.:..........::.|.:|.:
  Fly    57 RVLLVDGLVYGVR----GILGFVTTPVMGAISD-FHGRKVVMLLAVATTYAPIPFMMLKSWWFFA 116

  Fly   191 LPMEFGAYCEAIVPALFGGLTFCLMAIYSYITIATPEEDRVFRFGIF-AMFVTGVPFIGQPISGV 254
            : :...:.|         |.|:  .:..:|:...|..|:|...:||. |.|..|:.| ...:...
  Fly   117 I-LTVSSIC---------GSTY--SSSLAYVADTTTVENRSKGYGIVAASFGAGIAF-SPSLGNY 168

  Fly   255 LFTTLGYTWSFASAIVFQLIAIFYIIFFIKEVKTTPTTSTTANEPPP-LPTSLPPKQQ------- 311
            |..:.|.......|.:..||.|.:|||.:.|.......:...:|... ....:.||::       
  Fly   169 LMKSYGSASVILIAAITGLINIMFIIFAVPESLVLKEKNNMLDEESDNKMEDINPKERKEILNRE 233

  Fly   312 -------GADNMAYETT-NL---DEL--QGNKNVNFQ--LTPQMEPKVEVVPPKRSLLKELFDPT 361
                   .|:...:.|: ||   .||  |.||..|.|  ||.                ||..|..
  Fly   234 EKLNNHVSANKSNHGTSQNLVTNKELGQQFNKEENLQNDLTE----------------KEKIDNG 282

  Fly   362 LVLDCIRFPLVKRPNNGRMLLILLLCAYFLTVGPTSGENDYWYRFTLKKLAWNGNDFSIYLTLSS 426
            .:.....:.::::....:.||::.|.. ||::.|.:|.:               :...:||..:.
  Fly   283 SLNSSDLWEVLRKSRKDKNLLVIYLIT-FLSIWPFAGVD---------------STAPVYLKTNM 331

  Fly   427 GAALVGTFIGTAILSKLLKVSDSMIG------------MLSALSIVCSRVLFAFSSSTASFYVAG 479
            |.......:...:||.|...|:.::|            .|..|.::.....|.|.:....::::.
  Fly   332 GFEYEEVSMMLGLLSVLAITSNLLLGYIINIVGAKWSIRLGLLLLLLQLFFFGFGTHHWMYWLSS 396

  Fly   480 VVDMFVSLRVIAIKTIGSSIVAGDELSKMYSIFGISEPIAQFIFPPIFSEIY-------KSTVD- 536
            ::....::...|...:.|...:.|....:..|....|.:::.:.|..|..::       |:.|: 
  Fly   397 ILAALATIIPAANNAVASIYASPDNRGAVLGIISGIECLSEGVGPAFFGVLFFIFQDDSKNKVNS 461

  Fly   537 --SFPGAIWLFGEIFYIPNVLVFVVCYFLLRRR-------------KANEE------KSVVEMEQ 580
              |.|..|...|       |.|.:|....:::.             .|:|:      |:..:.|:
  Fly   462 PISMPFVISAIG-------VFVAIVLTGFIKKETVEKAPLIYKIIDDASEDEVEPLAKTTFKYEK 519

  Fly   581 NGG 583
            |.|
  Fly   520 NNG 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31321NP_731899.1 MFS 141..>271 CDD:119392 24/130 (18%)
MFS_1 143..>271 CDD:284993 24/128 (19%)
MFS <379..559 CDD:119392 34/201 (17%)
CG18281NP_649236.1 MFS 25..485 CDD:119392 90/484 (19%)
MFS_1 30..441 CDD:284993 79/433 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2816
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.