DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31321 and mfsd14a2

DIOPT Version :9

Sequence 1:NP_731899.1 Gene:CG31321 / 318681 FlyBaseID:FBgn0051321 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_955878.1 Gene:mfsd14a2 / 322115 ZFINID:ZDB-GENE-030131-834 Length:493 Species:Danio rerio


Alignment Length:468 Identity:90/468 - (19%)
Similarity:160/468 - (34%) Gaps:127/468 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 PIIGEAL-------SFTCQIISSIFFESLP---MEFGAYCEAIVPALFGGLTFCLMAIYSYITIA 224
            |:|| ||       ||   ::.::||...|   |:...:....|.::.|........|::|:...
Zfish    90 PLIG-ALSDVWGRKSF---LLLTVFFTCAPIPLMKISPWWYFAVISMSGVFAVTFSVIFAYVADI 150

  Fly   225 TPEEDRVFRFGI----FAMFVTGVPFIGQPISGVLFTTLGYTWSFASAIVFQLIAIFYIIFFIKE 285
            |.|.:|...:|:    ||..:...|.||..:|.|...||       ..|:...||:..|.|.:..
Zfish   151 TQEHERSTAYGLVSATFAASLVTSPAIGAYLSEVYGDTL-------VVILATAIALLDICFILVA 208

  Fly   286 VKTTPTTSTTANEPPPLPTSLPPKQQGADNMAYETTNLDELQGNKNVNFQLTPQMEPKVEVVPPK 350
            |            |..||..:.|...||. :::|..:                          |.
Zfish   209 V------------PESLPEKMRPASWGAP-ISWEQAD--------------------------PF 234

  Fly   351 RSLLKELFDPTLVLDCIRFPLVKRPNNGRMLLILLLCAYFLTVGPTSGENDYWYRFTLKKLAWNG 415
            .||.|...|.|::|.||                    ..||:..|.:|....::.:..:.:.:..
Zfish   235 ASLRKVGQDSTVLLICI--------------------TVFLSYLPEAGPYSSFFLYLRQVIGFTS 279

  Fly   416 NDFSIYLTLSSGAALVGTFIGTAILSKLLKVSDSMIGMLSALSI-VCSRVLFAFSSSTASFYVAG 479
            ...:.::.:   ..::.....|.:|..|::...:...:|..|.. :.....:.|.|.....:.||
Zfish   280 ETVAAFIAV---VGILSILAQTVVLGILMRSIGNKNTILLGLGFQILQLAWYGFGSQPWMMWAAG 341

  Fly   480 VVDMFVSLRVIAIKTIGSSIVAGDELSKMYSIF--------GISEPIAQFIF------------- 523
            .|....|:...||..|.|.....|:...:..:.        |:...:..|:|             
Zfish   342 AVAAMSSITFPAISAIVSRNADPDQQGVVQGMITGIRGLCNGLGPALYGFVFYLFHVELSEMDPA 406

  Fly   524 --------PPIFSEIYKSTVDSFPGAIWLFGEIFYIPNVLV--FVVCYFLLRRRKANEEKSVVEM 578
                    |.:.:...:|.:  .||..:|||....:.::||  |:..:..|..|..:.:|     
Zfish   407 ESPEKGVKPNMANPTDESAI--IPGPPFLFGACSVLLSLLVALFIPEHNGLNLRPGSYKK----- 464

  Fly   579 EQNGGANGGNRAS 591
             .|.||...:.:|
Zfish   465 -HNNGAQSHSHSS 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31321NP_731899.1 MFS 141..>271 CDD:119392 29/114 (25%)
MFS_1 143..>271 CDD:284993 29/114 (25%)
MFS <379..559 CDD:119392 33/211 (16%)
mfsd14a2NP_955878.1 MFS 40..393 CDD:119392 72/375 (19%)
MFS_1 42..386 CDD:284993 71/368 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.