DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31321 and Slc46a1

DIOPT Version :9

Sequence 1:NP_731899.1 Gene:CG31321 / 318681 FlyBaseID:FBgn0051321 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001013991.1 Gene:Slc46a1 / 303333 RGDID:1309472 Length:459 Species:Rattus norvegicus


Alignment Length:439 Identity:89/439 - (20%)
Similarity:156/439 - (35%) Gaps:96/439 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 GGWADRYNKRKPCMIMPIIGEALSFTCQIISSIFFESLPMEFG------AYCEAIVPALFGGLTF 212
            |.|:||.. |:|.:::..:|..|    |.:.|||...|.:..|      |.|     ||.|....
  Rat   105 GAWSDRVG-RRPLLVLASLGLLL----QAVVSIFVVQLQLHIGFFVLGRALC-----ALLGDFNG 159

  Fly   213 CLMAIYSYITIATPEEDRVFRFGIFAMFVTGVPFIGQPISGVLFTTLGYTWSFASAIVFQLIAIF 277
            .|.|.::.:...:....|.||..:....:.....:...:.|......||...|..|:...::...
  Rat   160 LLAASFASVADVSSNHSRTFRMALLEACIGVAGTLASLLGGHWLRAQGYANPFWLALAVLIVMTL 224

  Fly   278 YIIFFIKEVKTTPTTSTTANEPPPLPTSLPPKQQGADNMAYETTNLDELQGNKNVNFQLTPQMEP 342
            |..|...|         |..||                   ::|.|..|:.::::          
  Rat   225 YAAFCFGE---------TVKEP-------------------KSTRLFTLRHHRSI---------- 251

  Fly   343 KVEVVPPKRSLLKELFDPTLVLDCIRFPLVKRPNNGRMLLILLLCAYFLTVGPTSGENDYWYRFT 407
                                    ::..:|..|...||.|.|...|.|:.|....|..|....:.
  Rat   252 ------------------------VQLYVVPAPEKSRMHLALYSLAIFVVVTVHFGAQDILTLYE 292

  Fly   408 LK-KLAWNGNDFSIYLTLSSGAALVGTFIGTAILSKLLKVSDSMIGMLSALSIVCSRVLFAFSSS 471
            |. .|.|:..... |.:.:.....:.:.:|..:|...|  :|:.:..:.....:...|:|||::.
  Rat   293 LSTPLCWDSKLIG-YGSAAQHLPYLTSLLGLRLLQFCL--ADTWVAEIGLAFNILGMVVFAFATI 354

  Fly   472 TASFYVAGVVDMFVSL---RVIAIKTIGSSIVAGDELSKMYSIFGISEPIAQFIFPPIFSEIYKS 533
            |...: .|...:|:||   .||..|.  |.:|:..|...::|.......:|..:...||:.:|.:
  Rat   355 TPLMF-TGYGLLFLSLVTTPVIRAKL--SKLVSESEQGALFSAVACVNSLAMLMASGIFNSLYPA 416

  Fly   534 TVDSFPGAIWLFGE-IFYIPNVLVFVVCYFLLRRRKANEEKSVVEMEQN 581
            |::...|..:|.|. :.:||.:|:.|:       .|.|......:..||
  Rat   417 TLNFMKGFPFLLGAGLLFIPAILIGVL-------EKVNPHPEFQQFPQN 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31321NP_731899.1 MFS 141..>271 CDD:119392 29/122 (24%)
MFS_1 143..>271 CDD:284993 29/122 (24%)
MFS <379..559 CDD:119392 44/184 (24%)
Slc46a1NP_001013991.1 MFS 22..444 CDD:421695 85/423 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D333052at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23507
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.