DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31321 and SLC46A3

DIOPT Version :9

Sequence 1:NP_731899.1 Gene:CG31321 / 318681 FlyBaseID:FBgn0051321 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001129391.1 Gene:SLC46A3 / 283537 HGNCID:27501 Length:463 Species:Homo sapiens


Alignment Length:476 Identity:101/476 - (21%)
Similarity:185/476 - (38%) Gaps:121/476 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 LAADVSGKRAPMAAIFPLIVLLFAGGWADRYNKRKPCMIMPIIGEALSFTCQIISSIFFESLPME 194
            |..|:||....:.:.|.|:.:      :|.|.::.| ||:..:| ||:.:..:....:| :.|.:
Human    74 LQMDISGLIPGLVSTFILLSI------SDHYGRKFP-MILSSVG-ALATSVWLCLLCYF-AFPFQ 129

  Fly   195 -------FGAYCEAIVPALFGGLTFCLMAIYSYITIATPE-EDRVFRFGIFAM---FVTGVPFIG 248
                   .||:|        |..|....|.::||.....| :.:..|..|...   .|||:..:.
Human   130 LLIASTFIGAFC--------GNYTTFWGACFAYIVDQCKEHKQKTIRIAIIDFLLGLVTGLTGLS 186

  Fly   249 QPISGVLFTTLGYTWSFASAIVFQLIAIFYIIFF----IKEVKTTPTTSTTANEPPPLPTSLPPK 309
               ||.....||:.|||....|...:.:.||:||    :||..:...|.:.:             
Human   187 ---SGYFIRELGFEWSFLIIAVSLAVNLIYILFFLGDPVKECSSQNVTMSCS------------- 235

  Fly   310 QQGADNMAYETTNLDELQGNKNVNFQLTPQMEPKVEVVPPKRSLLKELFDPTLVLDCIRFPLVKR 374
             :|..|:.|.|..|.:....|                   :|.||           |        
Human   236 -EGFKNLFYRTYMLFKNASGK-------------------RRFLL-----------C-------- 261

  Fly   375 PNNGRMLLILLLCAYFLTVG--PTSGENDYWYRFTL----KKLAWNGNDFSIYLTLSSGAALVGT 433
                 :||..::..:|:.:|  |.         |.|    ..|.|| ..|..|.:....|:.:.:
Human   262 -----LLLFTVITYFFVVIGIAPI---------FILYELDSPLCWN-EVFIGYGSALGSASFLTS 311

  Fly   434 FIGTAILSKLLK-VSDSMIGMLSALSIVCSRVLFAFSSSTASFYVAGVVDMFVSLRVIAIKTIGS 497
            |:|..:.|..:: :..:.||:.:.::   ...:.||:|:|...::|.|..:|..:....::::.|
Human   312 FLGIWLFSYCMEDIHMAFIGIFTTMT---GMAMTAFASTTLMMFLARVPFLFTIVPFSVLRSMLS 373

  Fly   498 SIVAGDELSKMYSIFGISEPIAQFIFPPIFSEIYKSTVDSFPGAIWLFGE-IFYIPNVLVFVV-C 560
            .:|...|...:::.....|.:........|:.||.:||..:||..:|... :..:|.:.:.|| |
Human   374 KVVRSTEQGTLFACIAFLETLGGVTAVSTFNGIYSATVAWYPGFTFLLSAGLLLLPAISLCVVKC 438

  Fly   561 -------YFLLRRRKANEEKS 574
                   |.||.:.:::|:.|
Human   439 TSWNEGSYELLIQEESSEDAS 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31321NP_731899.1 MFS 141..>271 CDD:119392 33/140 (24%)
MFS_1 143..>271 CDD:284993 33/138 (24%)
MFS <379..559 CDD:119392 38/187 (20%)
SLC46A3NP_001129391.1 MFS_1 81..399 CDD:311564 80/407 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D333052at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23507
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.