DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31321 and Mfsd14a

DIOPT Version :9

Sequence 1:NP_731899.1 Gene:CG31321 / 318681 FlyBaseID:FBgn0051321 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001316129.1 Gene:Mfsd14a / 103689987 RGDID:9294064 Length:490 Species:Rattus norvegicus


Alignment Length:437 Identity:78/437 - (17%)
Similarity:150/437 - (34%) Gaps:121/437 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 PIIGEAL-------SFTCQIISSIFFESLP---MEFGAYCEAIVPALFGGLTFCLMAIYSYITIA 224
            |:|| ||       ||   ::.::||...|   |:...:....|.::.|........:::|:...
  Rat    90 PLIG-ALSDVWGRKSF---LLLTVFFTCAPIPLMKISPWWYFAVISVSGVFAVTFSVVFAYVADI 150

  Fly   225 TPEEDRVFRFGI----FAMFVTGVPFIGQPISGVLFTTLGYTWSFASAIVF-QLIAIFYIIFFIK 284
            |.|.:|...:|:    ||..:...|.||        ..||..:..:..:|. ..||:..|.|.:.
  Rat   151 TQEHERSMAYGLVSATFAASLVTSPAIG--------AYLGRVYGDSLVVVLATAIALLDICFILV 207

  Fly   285 EVKTTPTTSTTANEPPPLPTSLPPKQQGADNMAYETTNLDELQGNKNVNFQLTPQMEPKVEVVPP 349
            .|            |..||..:.|...||. :::|                   |.:|       
  Rat   208 AV------------PESLPEKMRPASWGAP-ISWE-------------------QADP------- 233

  Fly   350 KRSLLKELFDPTLVLDCIRFPLVKRPNNGRMLLILLLC-AYFLTVGPTSGENDYWYRFTLKKLAW 413
                               |..:|:.  |:..::||:| ..||:..|.:|:...::.:..:.:.:
  Rat   234 -------------------FASLKKV--GQDSIVLLICITVFLSYLPEAGQYSSFFLYLRQIMKF 277

  Fly   414 NGNDFSIYLTLSSGAALVGTFIGTAILSKLLKVSDSMIGMLSALSI-VCSRVLFAFSSSTASFYV 477
            :....:.::.:   ..::.....|.:||.|::...:...:|..|.. :.....:.|.|.....:.
  Rat   278 SPESVAAFIAV---LGILSIIAQTIVLSLLMRSIGNKNTILLGLGFQILQLAWYGFGSEPWMMWA 339

  Fly   478 AGVVDMFVSLRVIAIKTIGSSIVAGDELSKMYSIF--------GISEPIAQFIFPPIFSEIYKST 534
            ||.|....|:...|:..:.|.....|:...:..:.        |:...:..|||.....|:.:..
  Rat   340 AGAVAAMSSITFPAVSALVSRTADADQQGVVQGMITGIRGLCNGLGPALYGFIFYIFHVELKELP 404

  Fly   535 VDS------------------FPGAIWLFGEIFYIPNVLVFVVCYFL 563
            :..                  .||..:|||....:   |..:|..|:
  Rat   405 ITGPDLGTNTSPQHHFEQNSIIPGPPFLFGACSVL---LALLVALFI 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31321NP_731899.1 MFS 141..>271 CDD:119392 25/114 (22%)
MFS_1 143..>271 CDD:284993 25/114 (22%)
MFS <379..559 CDD:119392 33/207 (16%)
Mfsd14aNP_001316129.1 MFS 40..397 CDD:119392 69/381 (18%)
MFS_1 42..386 CDD:284993 66/370 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.