DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir8a and Ir93a

DIOPT Version :9

Sequence 1:NP_727328.1 Gene:Ir8a / 31867 FlyBaseID:FBgn0052704 Length:936 Species:Drosophila melanogaster
Sequence 2:NP_650924.3 Gene:Ir93a / 42471 FlyBaseID:FBgn0259215 Length:868 Species:Drosophila melanogaster


Alignment Length:575 Identity:113/575 - (19%)
Similarity:211/575 - (36%) Gaps:173/575 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   309 DYNWLDMVHWS---NFLAYAPPLPHIQDQFQSPVPGLTFAVNISAGYYSSEHEAKTDLAAWSSVG 370
            ::.::::.:|:   .|:......|||:..|:          ||:                     
  Fly   401 NFEFINIGYWTPVLGFVCQELAFPHIEHHFR----------NIT--------------------- 434

  Fly   371 EMRLLNETISPARRFFRIGTAESIPWSYLRREEGTGELIRDRSGLPIWEGYCIDFIIRLSQKLNF 435
             |.:|              |..:.||..|.: ...|.::..:       |..::.:..||:.|||
  Fly   435 -MDIL--------------TVHNPPWQILTK-NSNGVIVEHK-------GIVMEIVKELSRALNF 476

  Fly   436 EFEIVAPEVGHMGELNELGEW---------------DGVVG-----------DLVRGETDFAIAA 474
            .:           .|:|...|               |.:||           ::|:| ..|.|||
  Fly   477 SY-----------YLHEASAWKEEDSLSTSAGGNESDELVGSMTFRIPYRVVEMVQG-NQFFIAA 529

  Fly   475 LKMYSE--REEVIDFLPPYYEQTGISIAIRKPVRRTSLFKFMTVLRLEVWLSIVAALVGTAIMIW 537
            :....|  .::..::..|...|. .|...|||...:.::.|.....:|.|..::..::.||..::
  Fly   530 VAATVEDPDQKPFNYTQPISVQK-YSFITRKPDEVSRIYLFTAPFTVETWFCLMGIILLTAPTLY 593

  Fly   538 FMDKYSPYSSRNNRQAYPYACREF------TLRESFWFALTSFTPQGGGEAPKAISGRMLVAAYW 596
            .:::.:|             .:|.      |::..||:...:...|||...|.|.|||::|..:|
  Fly   594 AINRLAP-------------LKEMRIVGLSTVKSCFWYIFGALLQQGGMYLPTADSGRLVVGFWW 645

  Fly   597 LFVVLMLATFTANLAAFLTVERMQTPVQSLEQLARQSRINYTVVKDSDTHQYFVNMKFAEDTLYR 661
            :.|::::.|:..||.||||..:.|..|..|.||              :.|:..|.......|.:.
  Fly   646 IVVIVLVTTYCGNLVAFLTFPKFQPGVDYLNQL--------------EDHKDIVQYGLRNGTFFE 696

  Fly   662 MWKELALNASKDFKKF----RIWDYPIKEQYGHILLAINSSQPVADAKEGFANVDAHENADYAFI 722
            .:  :.....:|||.:    :|:....:|.    :.|:...:.:        |:|...|....  
  Fly   697 RY--VQSTTREDFKHYLERAKIYGSAQEED----IEAVKRGERI--------NIDWRINLQLI-- 745

  Fly   723 HDSAEIKYEITRNCNLTEVGEVFAEQPYAVAVQQGS---HLGDELSYAILELQKDRFFEELKAKY 784
               .:..:|..:.|:.....|.|.::..|:.|...|   ||   ::..|..:.:..|.|.     
  Fly   746 ---VQRHFEREKECHFALGRESFVDEQIAMIVPAQSAYLHL---VNRHIKSMFRMGFIER----- 799

  Fly   785 WNQSNLPN---CPLSEDQEGIT-----LESLGGVFIATLFGLVLAMMTLGMEVLY 831
            |:|.|||:   |.....|..:|     ::.:.|.|:..|.|..||::.:..|..|
  Fly   800 WHQMNLPSAGKCNGKSAQRQVTNHKVNMDDMQGCFLVLLLGFTLALLIVCGEFWY 854

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir8aNP_727328.1 PBP2_iGluR_putative 383..786 CDD:270435 87/443 (20%)
Lig_chan 520..818 CDD:278489 67/318 (21%)
Ir93aNP_650924.3 Periplasmic_Binding_Protein_Type_2 429..>697 CDD:328725 71/361 (20%)
Lig_chan 576..836 CDD:306551 66/313 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.