DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir8a and GRIK1

DIOPT Version :10

Sequence 1:NP_727328.1 Gene:Ir8a / 31867 FlyBaseID:FBgn0052704 Length:936 Species:Drosophila melanogaster
Sequence 2:NP_001317923.1 Gene:GRIK1 / 2897 HGNCID:4579 Length:949 Species:Homo sapiens


Alignment Length:71 Identity:22/71 - (30%)
Similarity:30/71 - (42%) Gaps:14/71 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 ETASD-KLYSFIGSRKECIPVGHCGKPEEIANIIVFLADRNLSSYIIGQSIVADGGSTLVMGMQT 268
            |.||| .|||.:|:....:.|...|         |.|..|:.|.|  |..::  ..|.|..|.||
Human   373 ENASDIALYSGLGAAVVAVAVLVIG---------VTLYRRSHSDY--GVDVI--DSSALTGGFQT 424

  Fly   269 HDLMSV 274
            .:..:|
Human   425 FNFKTV 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir8aNP_727328.1 PBP2_iGluR_putative 383..786 CDD:270435
GRIK1NP_001317923.1 PBP1_iGluR_Kainate 38..431 CDD:380605 22/71 (31%)
Periplasmic_Binding_Protein_Type_2 446..815 CDD:473866
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.