DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31296 and PRY3

DIOPT Version :9

Sequence 1:NP_001262608.1 Gene:CG31296 / 318668 FlyBaseID:FBgn0051296 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_012457.1 Gene:PRY3 / 853367 SGDID:S000003614 Length:881 Species:Saccharomyces cerevisiae


Alignment Length:124 Identity:27/124 - (21%)
Similarity:49/124 - (39%) Gaps:26/124 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 CQLPYCGT---NNLAC--NNPSKF------------SVMCPPNARTLSMSTYRNLLLIAFNEFRN 73
            |...||||   |.:.|  |.|..:            |.:...::.:.|.||..:.:....:....
Yeast   127 CGYKYCGTTWNNYIVCSYNPPGNYLGEFAEEVEPLISTVSSSSSSSSSTSTTSDTVSTISSSIMP 191

  Fly    74 YTASGKQKYLKAAAARMSRLSYSMELEDLARLAVITCSTHKFCLNSQEFYYVGTNIGST 132
            ..|.|....:.:||:..|..|.::   :.|:.|.:|.|:.....:|.|      ::||:
Yeast   192 AVAQGYTTTVSSAASSSSLKSTTI---NPAKTATLTASSSTVITSSTE------SVGSS 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31296NP_001262608.1 SCP_euk 61..214 CDD:240180 14/72 (19%)
PRY3NP_012457.1 CAP_PRY1-like 24..152 CDD:349403 9/24 (38%)
ser_rich_anae_1 <598..>855 CDD:411418
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.