DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31296 and CRISPLD2

DIOPT Version :9

Sequence 1:NP_001262608.1 Gene:CG31296 / 318668 FlyBaseID:FBgn0051296 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_113664.1 Gene:CRISPLD2 / 83716 HGNCID:25248 Length:497 Species:Homo sapiens


Alignment Length:311 Identity:59/311 - (18%)
Similarity:91/311 - (29%) Gaps:109/311 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IPFGCSKLVDFCQLPYCGTNNLACNNPSKFSVMCPPNARTLSMSTYRNL--------LLIAFNEF 71
            ||.|...||       ||:......|.:....:........|.|..|..        :|:..|:.
Human     9 IPLGLLFLV-------CGSQGYLLPNVTLLEELLSKYQHNESHSRVRRAIPREDKEEILMLHNKL 66

  Fly    72 RNYTASGKQKYLKAAAARMSRLSYSMELEDLARLAVITCS-THKFCLNSQEFYYVGTNIGSTHYL 135
            |.        .::..|:.|..:::..|||..|......|. .|.   .:.....:|.|:|:    
Human    67 RG--------QVQPQASNMEYMTWDDELEKSAAAWASQCIWEHG---PTSLLVSIGQNLGA---- 116

  Fly   136 GNLNDYEDLELMLRIIQHWTRYAD--------YVNIKMGVY-MPTTL---------GKSGIAKAL 182
                             ||.||..        |..:|...| .|:..         |........
Human   117 -----------------HWGRYRSPGFHVQSWYDEVKDYTYPYPSECNPWCPERCSGPMCTHYTQ 164

  Fly   183 LLMADRNTHVGC---SAMRFTV------HSVHNFVFLCAFST--DLFVERPIYRMSMRPGAACKR 236
            ::.|..| .:||   :..:.||      ::|:   |:|.:|.  :...|.|     .:.|..|..
Human   165 IVWATTN-KIGCAVNTCRKMTVWGEVWENAVY---FVCNYSPKGNWIGEAP-----YKNGRPCSE 220

  Fly   237 LDPTYSA-----LCAVGENY------------------ENNKPMLNARVFQ 264
            ..|:|..     ||...|.|                  |.|...|..||.:
Human   221 CPPSYGGSCRNNLCYREETYTPKPETDEMNEVETAPIPEENHVWLQPRVMR 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31296NP_001262608.1 SCP_euk 61..214 CDD:240180 33/188 (18%)
CRISPLD2NP_113664.1 SCP_euk 56..201 CDD:240180 32/180 (18%)
LCCL 286..370 CDD:128866
LCCL 387..479 CDD:128866
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.