DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31296 and CRISPLD1

DIOPT Version :9

Sequence 1:NP_001262608.1 Gene:CG31296 / 318668 FlyBaseID:FBgn0051296 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_113649.1 Gene:CRISPLD1 / 83690 HGNCID:18206 Length:500 Species:Homo sapiens


Alignment Length:245 Identity:52/245 - (21%)
Similarity:89/245 - (36%) Gaps:97/245 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 NARTLSMSTYRNLLLIAFNEFRNYTASGKQKYLKAAAARMSRL-SYSMELEDLARLAVITCSTHK 114
            :.||.|..:.||.::                    :|.:||:: |..:.|.|..:  ..||:.::
Human   270 HVRTRSDDSSRNEVI--------------------SAQQMSQIVSCEVRLRDQCK--GTTCNRYE 312

  Fly   115 F---CLNSQEFYYVGTNIGSTHYLGNLNDYEDLELMLRIIQHWTRY------ADYVNIKMGVYMP 170
            .   ||:|:     ...|||.||          |:...|.:....|      ..:|:|       
Human   313 CPAGCLDSK-----AKVIGSVHY----------EMQSSICRAAIHYGIIDNDGGWVDI------- 355

  Fly   171 TTLGKSGIAKALLLMADRN--THVG--CSAMRFTVHSVHNFVFLCAFSTDLFVER--PIYRMSMR 229
            |..|:    |...:.::||  ..:|  .||..|||..    |.:.|.:.:..||:  |.:    :
Human   356 TRQGR----KHYFIKSNRNGIQTIGKYQSANSFTVSK----VTVQAVTCETTVEQLCPFH----K 408

  Fly   230 PGAACKRL---------DPTYSALCAVGENYENNKPMLNARVFQLPLDLS 270
            |.:.|.|:         :|.|:.             ::..||:.   |||
Human   409 PASHCPRVYCPRNCMQANPHYAR-------------VIGTRVYS---DLS 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31296NP_001262608.1 SCP_euk 61..214 CDD:240180 36/166 (22%)
CRISPLD1NP_113649.1 SCP_euk 63..207 CDD:240180
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 254..281 3/10 (30%)
LCCL 291..375 CDD:128866 23/111 (21%)
LCCL 392..483 CDD:128866 14/71 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.