powered by:
Protein Alignment CG31296 and AT4G33730
DIOPT Version :9
Sequence 1: | NP_001262608.1 |
Gene: | CG31296 / 318668 |
FlyBaseID: | FBgn0051296 |
Length: | 280 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_195099.1 |
Gene: | AT4G33730 / 829515 |
AraportID: | AT4G33730 |
Length: | 172 |
Species: | Arabidopsis thaliana |
Alignment Length: | 43 |
Identity: | 11/43 - (25%) |
Similarity: | 13/43 - (30%) |
Gaps: | 19/43 - (44%) |
- Green bases have known domain annotations that are detailed below.
Fly 24 DF----CQLPYC--------------GTNNLACNNPSKFSVMC 48
|| |..|.| |.....|||.:.. |:|
plant 117 DFYSNSCHGPACGHYTQVVWRGSARLGCGKAKCNNGASI-VVC 158
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG31296 | NP_001262608.1 |
SCP_euk |
61..214 |
CDD:240180 |
|
AT4G33730 | NP_195099.1 |
CAP_PR-1 |
39..172 |
CDD:349400 |
11/43 (26%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1528782at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.