powered by:
Protein Alignment CG31296 and AT3G09590
DIOPT Version :9
Sequence 1: | NP_001262608.1 |
Gene: | CG31296 / 318668 |
FlyBaseID: | FBgn0051296 |
Length: | 280 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_187570.1 |
Gene: | AT3G09590 / 820116 |
AraportID: | AT3G09590 |
Length: | 186 |
Species: | Arabidopsis thaliana |
Alignment Length: | 67 |
Identity: | 13/67 - (19%) |
Similarity: | 20/67 - (29%) |
Gaps: | 34/67 - (50%) |
- Green bases have known domain annotations that are detailed below.
Fly 190 THVGCSAMRFTVHSVHNFVFLCAFSTDLFVERPIYRMSMRPGAACKRLDPTYSALCAVGENYENN 254
|.|||: |...|:...::.:|.: ||. .|||..
plant 153 TAVGCA--RVKCHNGRGYLVVCEY------------------------DPR--------GNYEGE 183
Fly 255 KP 256
:|
plant 184 RP 185
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1528782at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.