DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31296 and Crisp4

DIOPT Version :9

Sequence 1:NP_001262608.1 Gene:CG31296 / 318668 FlyBaseID:FBgn0051296 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001333976.1 Gene:Crisp4 / 78081 MGIID:1925331 Length:293 Species:Mus musculus


Alignment Length:164 Identity:29/164 - (17%)
Similarity:52/164 - (31%) Gaps:56/164 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 NEFRNYTASGKQKYLKAAAARMSRLSYSMELEDLARLAVITCS-----------THKFCLNSQEF 122
            |.||        :.:...|..|.::|:|....:.||:....|.           .:.||      
Mouse    93 NAFR--------RKVSPPARNMLKVSWSSAAAENARILARYCDKSDSDSLERRLPNTFC------ 143

  Fly   123 YYVGTNIGSTHYLGNLNDYEDLELMLRIIQHWTRYADYVNIKMGVYMPTTLGKSGIAKALLLMAD 187
               |.|:...||..:.:         ::|:.|...:.|  .|.|.: |:|...        :..|
Mouse   144 ---GENMLMEHYPSSWS---------KVIEIWFNESKY--FKYGEW-PSTDDD--------IETD 185

  Fly   188 RNTH--------VGCSAMRFTVHSVHNFVFLCAF 213
            ..|.        |||............::::|.:
Mouse   186 HYTQMVWASTYLVGCDVAACRRQKAATYLYVCHY 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31296NP_001262608.1 SCP_euk 61..214 CDD:240180 29/164 (18%)
Crisp4NP_001333976.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.