DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31296 and Pi16

DIOPT Version :9

Sequence 1:NP_001262608.1 Gene:CG31296 / 318668 FlyBaseID:FBgn0051296 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_076223.3 Gene:Pi16 / 74116 MGIID:1921366 Length:498 Species:Mus musculus


Alignment Length:246 Identity:49/246 - (19%)
Similarity:87/246 - (35%) Gaps:60/246 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 VMCPPNARTLSMSTYRNLLLIAFNEFRNYTASGKQ-------KY---LKAAAARMSRLSYSMELE 100
            ||.||....|       |||||.......|...||       :|   :...|:.|.::.:..||.
Mouse     9 VMLPPPLLLL-------LLLIATGPTTALTEDEKQTMVDLHNQYRAQVSPPASDMLQMRWDDELA 66

  Fly   101 DLARLAVITCSTHKFCLNSQEFYYVGTNIGSTHYLGNLNDYEDLELMLRIIQHWTRYADYVNIKM 165
            ..|:.....|...    :::|....|.|:.:      :.| |.:::.| .:.:|....:|.|...
Mouse    67 AFAKAYAQKCVWG----HNKERGRRGENLFA------ITD-EGMDVPL-AVGNWHEEHEYYNFST 119

  Fly   166 GVYMPTTLGKSGIAKALLLMADRNTHVGCSAMRFT-----VHSVHNFVFLCAFSTDLFVERPIYR 225
            ....|..:    ......::..:...:||.: .|.     |...:..:.:|.:.....|:.   |
Mouse   120 ATCDPNQM----CGHYTQVVWSKTERIGCGS-HFCETLQGVEEANIHLLVCNYEPPGNVKG---R 176

  Fly   226 MSMRPGAACKRLDPTYSALCAVGENYENN--KPMLN--------ARVFQLP 266
            ...:.|..|.:        |.:|.:.||:  :||.|        .||.::|
Mouse   177 KPYQEGTPCSQ--------CPLGYSCENSLCEPMRNPEKAQDSPPRVTEVP 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31296NP_001262608.1 SCP_euk 61..214 CDD:240180 30/167 (18%)
Pi16NP_076223.3 SCP_HrTT-1 35..168 CDD:240186 24/149 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..277 4/16 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 317..407
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 419..467
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.