DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31296 and crispl

DIOPT Version :9

Sequence 1:NP_001262608.1 Gene:CG31296 / 318668 FlyBaseID:FBgn0051296 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001025526.1 Gene:crispl / 594930 XenbaseID:XB-GENE-5768874 Length:314 Species:Xenopus tropicalis


Alignment Length:224 Identity:49/224 - (21%)
Similarity:83/224 - (37%) Gaps:57/224 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 PPNARTLSMSTYRNLLLIAFNEFRNYTASGKQKYLKAAAARMSRLSYSMELEDLARLAVITCSTH 113
            |.:|.:..:.:.|..:|...||.|..........||            |...|||     ..|..
 Frog    96 PFSALSTDLESNRQSILNVHNELRRNANPPPSNMLK------------MVWSDLA-----AKSAA 143

  Fly   114 KFCLNSQEFYYV-------GTNIGSTHYLGNLN-DYEDLELMLRIIQHWTRYADYVNIKMGVYMP 170
            |:..:.::::.:       |.:.|...::.:.. .:||      :|:     |.|..|:..:|  
 Frog   144 KWANSCKQYHSLKPERTIPGFSCGENLFMASYKASWED------VIR-----AFYSEIEDFLY-- 195

  Fly   171 TTLGKSGIAKALLLMADRNTH--------VGCSAMR--FTVHSVHNFVFLCAFS-TDLFVERPIY 224
               ||.  ||.:.|.....|.        |||:|.:  .|.||: .|.|:|.:: ...:....|.
 Frog   196 ---GKG--AKEVGLQILHFTQVMWFSSWLVGCAAAQCPITDHSL-EFYFVCHYAPAGNYGNVGIP 254

  Fly   225 RMSMRPGAACKRLDPTYSALCAVGENYEN 253
            ..:.:|...||  ....:.||..|.|::|
 Frog   255 YKTGKPCEDCK--SSCENGLCTNGCNFQN 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31296NP_001262608.1 SCP_euk 61..214 CDD:240180 38/170 (22%)
crisplNP_001025526.1 CAP_CRISP 106..245 CDD:349402 38/174 (22%)
Crisp 261..314 CDD:369954 7/23 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.