DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31296 and im:7150988

DIOPT Version :9

Sequence 1:NP_001262608.1 Gene:CG31296 / 318668 FlyBaseID:FBgn0051296 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_002667823.1 Gene:im:7150988 / 504039 ZFINID:ZDB-GENE-050309-169 Length:150 Species:Danio rerio


Alignment Length:135 Identity:31/135 - (22%)
Similarity:48/135 - (35%) Gaps:36/135 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 ASGKQKYLKA-----AAARMSRLSYSMELEDLARLA------VITCST--HKFCLNSQEFYYVGT 127
            ||.||::|:.     ...:...|.|.   |||.|.|      :::..:  |....|.:..||..:
Zfish     4 ASFKQEFLQTHNQYRHQHQAPPLVYR---EDLCRAAQKWAEHMLSKKSLGHSETENGENVYYSFS 65

  Fly   128 NIGSTHYLGNLNDYEDLELMLRIIQHW-TRYADYVNIKMGVYMPTT------LGKSGIAKALLLM 185
            ::..|. .|.           ..:..| :...||...|.| :.|.|      :.||.....:.|.
Zfish    66 SVKKTP-TGK-----------EAVDSWYSEIKDYNFAKSG-HQPKTGHFTQVVWKSSKELGVGLA 117

  Fly   186 ADRNT 190
            .|.||
Zfish   118 TDGNT 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31296NP_001262608.1 SCP_euk 61..214 CDD:240180 31/135 (23%)
im:7150988XP_002667823.1 SCP_GAPR-1_like 5..135 CDD:240182 30/134 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.