DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31296 and Glipr1l1

DIOPT Version :9

Sequence 1:NP_001262608.1 Gene:CG31296 / 318668 FlyBaseID:FBgn0051296 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_002729836.2 Gene:Glipr1l1 / 503139 RGDID:1563000 Length:235 Species:Rattus norvegicus


Alignment Length:197 Identity:42/197 - (21%)
Similarity:74/197 - (37%) Gaps:52/197 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LACNNPSKFSVMCPPNARTLSMSTYRNLLLIAFNEFRNYTASGKQKYLKAAAARMSRLSYSMELE 100
            :|...|..|..:. |...|::...::|..|.:.||.|        :.::..|:.|::||:...|.
  Rat    18 VASRLPKAFGKVL-PRVPTINDPEFKNGFLNSHNEAR--------RKVQPPASNMNQLSWDKSLA 73

  Fly   101 DLARLAVITCS-THKFCLN-----SQEFYYVGTNIGSTHYLGNLNDY-EDLELMLRIIQHWTRYA 158
            .||:.....|. :|..|.:     ::::.|:|.||    |||.::.. ||:     :...:....
  Rat    74 KLAKSWTRECKFSHNPCTSKRHGCTKDYDYIGENI----YLGKIDARPEDV-----VFSWYNETK 129

  Fly   159 DY------VNIKMGVYMPTTLGKSGIAKALLLMADRNTHVGCSAMRFTVHSVHNFVFLCAFSTDL 217
            ||      .....|.|......|:             ..:||        ::.|...|..:|..|
  Rat   130 DYNFDDNTCTKTCGHYTQVVWAKT-------------LKIGC--------AISNCPHLTGYSAGL 173

  Fly   218 FV 219
            ||
  Rat   174 FV 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31296NP_001262608.1 SCP_euk 61..214 CDD:240180 33/165 (20%)
Glipr1l1XP_002729836.2 SCP 40..181 CDD:294090 37/174 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.