DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31296 and Ag5r

DIOPT Version :9

Sequence 1:NP_001262608.1 Gene:CG31296 / 318668 FlyBaseID:FBgn0051296 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001245671.1 Gene:Ag5r / 44631 FlyBaseID:FBgn0015010 Length:256 Species:Drosophila melanogaster


Alignment Length:260 Identity:77/260 - (29%)
Similarity:122/260 - (46%) Gaps:16/260 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LSGFIFVALLNFIPFGCSKLVDFCQLPYCGTNNLACNNPSKFSVMCPPNARTLSMSTYRNLLLIA 67
            :..|:.:..|: :.||.:...|:|:.....|.||.|:|...::..||.:|..|::|:.....|:|
  Fly     1 MRNFVIIFSLS-LAFGIASATDYCKKSCGSTKNLGCDNNGAWASSCPSDATLLTLSSAEKDALVA 64

  Fly    68 -FNEFRNYTASGKQKYLKAAAARMSRLSYSMELEDLARLAVITCS-THKFCLNSQEFYYVGTNIG 130
             .||:||:.|.|....| :||.||:.:.::.||..||.|.|.:|. .|..|.|:..|.:.|.|:.
  Fly    65 RTNEYRNHIAGGLNANL-SAACRMATIKWNDELAYLASLNVKSCQMKHDGCHNTDAFDWSGQNLA 128

  Fly   131 STHYLGNLNDYEDLELMLRIIQHWTRYADYVNIKMGVYM---PTTLGKSGIAKALLLMADRNTHV 192
            ...|...||....||..   :..|  |.:.|..|. .|:   |:......|....:|:|||||.|
  Fly   129 WMGYYNPLNVTHYLEWG---VDMW--YDEAVYTKQ-AYIDAYPSNYNGPAIGHFTVLVADRNTEV 187

  Fly   193 GCSAMRFTV--HSVHNFVFLCAFSTDLFVERPIYRMSMRPGAACKR-LDPTYSALCAVGENYENN 254
            ||:|..::|  .|...|:..|.::....:...:|....:..:.|.. .:|.|..||:..|.|..|
  Fly   188 GCAAATYSVSGQSYKAFLLACNYAATNVLGIKMYSSCSKAASKCTTGTNPKYKYLCSAKEEYNVN 252

  Fly   255  254
              Fly   253  252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31296NP_001262608.1 SCP_euk 61..214 CDD:240180 52/159 (33%)
Ag5rNP_001245671.1 SCP_euk 59..211 CDD:240180 52/158 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.