DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31296 and scpr-B

DIOPT Version :9

Sequence 1:NP_001262608.1 Gene:CG31296 / 318668 FlyBaseID:FBgn0051296 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster


Alignment Length:252 Identity:86/252 - (34%)
Similarity:127/252 - (50%) Gaps:13/252 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GCSKLVDFCQLPYCGTNNLACNNPSKFSVMCPPNARTLSMSTYRNLLLIAFNEFRNYTASGKQKY 82
            |.|...|:|.||.|...::||||...||..||.:.|.:.:..:..|:|..|||.||..|.||.:.
  Fly    14 GISLAADYCALPTCLDKHIACNNKGNFSENCPKDVREVKIEPHHKLILNLFNELRNNVAGGKIEG 78

  Fly    83 LKAAAARMSRLSYSMELEDLARLAVITC-STHKFCLNSQEFYYVGTNIGSTHYLGNLNDYEDLEL 146
            | ..|.||:::|:..||..||.|.|.|| |....|.:::.|.|.|.|.....|.|...:|.|.|:
  Fly    79 L-PKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRSTERFAYAGQNNALFQYSGAETEYTDAEI 142

  Fly   147 MLRIIQHWTRYADYVNIKMGVY--MPTTLGKSGIAKALLLMADRNTHVGCSAMRFTVHSVHNFVF 209
            :...|::|  :|:..|....:.  .|..|....:.|..:.:|::||||||:|:||:....::||.
  Fly   143 IKEQIENW--FAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVGCAAVRFSRDFYNHFVL 205

  Fly   210 LCAFSTDLFVERPIYRMSMRPGAACKR-----LDPTYSALCAVGENYENNKPMLNAR 261
            .|.|:|...|.:|:|....:....||.     .|  |..||...|.|:|.|.:.|.:
  Fly   206 TCNFATSNIVGQPVYTPGEKATTGCKNRYGAAYD--YPNLCYAKEIYDNEKVIENTQ 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31296NP_001262608.1 SCP_euk 61..214 CDD:240180 54/155 (35%)
scpr-BNP_650061.1 SCP_euk 58..210 CDD:240180 54/154 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.