DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31296 and CG11977

DIOPT Version :9

Sequence 1:NP_001262608.1 Gene:CG31296 / 318668 FlyBaseID:FBgn0051296 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_649855.3 Gene:CG11977 / 41076 FlyBaseID:FBgn0037650 Length:274 Species:Drosophila melanogaster


Alignment Length:253 Identity:51/253 - (20%)
Similarity:90/253 - (35%) Gaps:44/253 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DFCQLPYCGTN--NLACNNPSKF-SVMCPPNARTLSMSTYRNLLLIAFNEFRNYTASGKQKYLKA 85
            |:|....|..|  ::.|.  .|| |..|..|...:.||.||..::...|.||.....|.....: 
  Fly    43 DYCNADICPANKKHITCG--FKFWSTKCGRNHEGVRMSDYRYDIVRNVNNFRRKLEWGLGNLPR- 104

  Fly    86 AAARMSRLSYSMELEDLARLAVITCSTHKF--CLNSQEFYYVGTNIGSTHYLGNLNDYEDLE--- 145
             |.:...:.:..||..:|......|..|.|  |:|:  |.|..        :|..:|:..::   
  Fly   105 -AVKFKNIKWDDELSVMAMRVSNQCLQHTFSPCVNT--FLYKD--------VGESSDFVKVQNTS 158

  Fly   146 ---LMLRIIQHWTRY-----ADYVNIKMGVYMPTTLGKSGIAKALLLMADRNTHVGCSAMRFTVH 202
               .::..:..|..|     ..|||     ..|....:..:.....|:.::|..:||.    .|.
  Fly   159 KGFNVISFLNMWFEYHKMMKPSYVN-----NFPNIAPQDRLIIFANLIYEKNKKMGCG----MVK 214

  Fly   203 SVHNFVFLCAFSTDLFVERPIYRMSMR-PGAACKRLDPTYSALCAVGENYENNKPMLN 259
            |.......|.|...:...:.:|...:. |....::.:.|.|    :..|..:.:.::|
  Fly   215 SGQGRFLTCLFDKKIKPNQKLYTTRLNDPFRTNRKTNETES----IQSNSSSTEAIVN 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31296NP_001262608.1 SCP_euk 61..214 CDD:240180 31/165 (19%)
CG11977NP_649855.3 SCP_euk 81..226 CDD:240180 31/165 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.