powered by:
Protein Alignment CG31296 and CG31482
DIOPT Version :9
| Sequence 1: | NP_001262608.1 |
Gene: | CG31296 / 318668 |
FlyBaseID: | FBgn0051296 |
Length: | 280 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_731097.1 |
Gene: | CG31482 / 40806 |
FlyBaseID: | FBgn0051482 |
Length: | 195 |
Species: | Drosophila melanogaster |
| Alignment Length: | 33 |
Identity: | 11/33 - (33%) |
| Similarity: | 17/33 - (51%) |
Gaps: | 8/33 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 235 KRLDPTYSALCAVGENYENNKPMLNARVFQLPL 267
::|:.:.|| |:||..|..|.: |.||
Fly 63 EKLEHSSSA----GQNYGENLCMRS----QTPL 87
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| CG31296 | NP_001262608.1 |
SCP_euk |
61..214 |
CDD:240180 |
|
| CG31482 | NP_731097.1 |
SCP_GAPR-1_like |
21..149 |
CDD:240182 |
11/33 (33%) |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
1 |
1.010 |
- |
- |
|
D1528782at2759 |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
1 |
1.100 |
- |
- |
P |
PTHR10334 |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 3.010 |
|
Return to query results.
Submit another query.
