DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31296 and CG6628

DIOPT Version :9

Sequence 1:NP_001262608.1 Gene:CG31296 / 318668 FlyBaseID:FBgn0051296 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster


Alignment Length:260 Identity:77/260 - (29%)
Similarity:120/260 - (46%) Gaps:17/260 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LSGFIFVALLNFIPFGCSKLVDFCQLPYCGT--NNLACNNPSKFSVMCPPNARTLSMSTYRNLLL 65
            |.||:.||...  ....:...|:||...|.:  .::||.|..:....|.|:|..::::..::|:|
  Fly    11 LFGFLQVAFSQ--DNATAPPTDYCQSGLCPSLKKHIACKNKGELGKQCSPDAHLVNLTGLQDLIL 73

  Fly    66 IAFNEFRNYTASGKQKYLKAAAARMSRLSYSMELEDLARLAVITC-STHKFCLNSQEFYYVGTNI 129
            ...|..||..||||...| ....||:.|.:..||.|||.|.|..| ..|..|.|:.:|:..|.|:
  Fly    74 GEHNALRNVLASGKIINL-PKPDRMATLQWHSELADLATLNVKQCVLQHDSCHNTPDFHNSGQNL 137

  Fly   130 GSTH--YLGNLNDYEDLELMLRIIQHWTRYADYVNIKMGVYMPTTLGKSG--IAKALLLMADRNT 190
            ...:  .|....::.|..|:...|..|  :...:||..........||.|  |....::..|.||
  Fly   138 ALVNITLLPEDGNHTDECLVKESIGGW--WNQSINITKEQLQRFPKGKLGDSIRNFAVMARDNNT 200

  Fly   191 HVGCSAMRFTVHSVHN-FVFLCAFSTDLFVERPIYRMSMRPGAACKR-LDPTYSALCAVGENYEN 253
            ||||:|:||...:.|. |:..|.::::...:.|||:   .....|:. .|..|.:||..||.|::
  Fly   201 HVGCAALRFEKPAGHPLFLLACNYASNYVPDWPIYK---EKAIGCQSGSDLKYPSLCKAGEEYQD 262

  Fly   254  253
              Fly   263  262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31296NP_001262608.1 SCP_euk 61..214 CDD:240180 51/158 (32%)
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 51/158 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.