DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31296 and CG34049

DIOPT Version :9

Sequence 1:NP_001262608.1 Gene:CG31296 / 318668 FlyBaseID:FBgn0051296 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster


Alignment Length:169 Identity:36/169 - (21%)
Similarity:54/169 - (31%) Gaps:65/169 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SKLVDFCQLP----YCGTNNLAC------------NNPSKF-------------------SVMC- 48
            |.|..||:.|    :...|.|||            :.|.||                   .:.| 
  Fly    40 SCLTSFCRKPIKIYHNSRNYLACEVQRSQSINSIKSLPVKFPSTPNRSLNTEKDWSHGKRCLQCA 104

  Fly    49 PPNARTLSMSTYRNLLL-----IAFNEFRNYTAS-GKQKYLKAAAARMS----RLSYSMELEDLA 103
            .|..:|.|.|:.::..|     ....||..|... .::|.:|.|..|.:    ||..:..|:   
  Fly   105 APKCKTSSRSSIQSKKLKKDKKSLLKEFEIYKIPIIRRKPIKQAVLRETNKYRRLHNANPLK--- 166

  Fly   104 RLAVITCSTHKFCLNSQEFYYVGTNIGSTHYLGNLNDYE 142
                   ...|.|..:||:         ..:|.:||..|
  Fly   167 -------MDEKLCSYAQEW---------ADHLADLNKLE 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31296NP_001262608.1 SCP_euk 61..214 CDD:240180 19/92 (21%)
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 14/63 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.