DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31296 and CG17974

DIOPT Version :9

Sequence 1:NP_001262608.1 Gene:CG31296 / 318668 FlyBaseID:FBgn0051296 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster


Alignment Length:278 Identity:67/278 - (24%)
Similarity:106/278 - (38%) Gaps:59/278 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IFVALLNFIPFGCSKLVDFCQLPYC--GTNNLACNNPSKFSVMCPPNARTLSMSTYRNLLLIAFN 69
            ||..:...|   .:|...:|....|  |..::||.....|...|.|:|..:.:|.::...|.|.|
  Fly    10 IFQLIFQLI---LAKDYSWCDPDLCGNGVRHIACRTTGNFHRRCQPDAVQVDVSRHKADFLHAHN 71

  Fly    70 EFRNYTASGK-QKYLKAAAARMSRLSYSMELEDLARLAVITCS-THKFCLNSQEFYYVGTNIGST 132
            :.||:.|.|| ..|.  .||||:.:.:..||:.|:.|...||. .|..|.|:..:...|.|:.:.
  Fly    72 KRRNFLALGKVPGYY--PAARMATMVWDDELQYLSMLNTRTCKLDHDDCHNTYRYANSGQNLCAV 134

  Fly   133 HYLGNLNDYEDLELMLRIIQHWTRYADYVNIK------MGVYM-----------------PTTLG 174
                                 |...:.:||:.      :|::.                 |....
  Fly   135 ---------------------WRPRSPHVNVTSLVEECLGLWFNEFDLIDSSFIDSFKVTPIFED 178

  Fly   175 KSGIAKALLLMADRNTHVGCSAMRFT---VHSVHNFVFLCAFSTDLFVERPIYRMSMRPGAACKR 236
            ....|:   |..|:|..||||.||||   ..||:.:.|:|.:::...:..|:|............
  Fly   179 YGHFAE---LSVDKNFAVGCSIMRFTRPDYPSVYIYNFICNYASLYALGAPVYETGRAASRCTTG 240

  Fly   237 LDPTYSALCAVGENYENN 254
            ....|..||:..|.|:.|
  Fly   241 KSHFYPGLCSTREVYDPN 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31296NP_001262608.1 SCP_euk 61..214 CDD:240180 45/180 (25%)
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 45/180 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.