DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31296 and R3hdml

DIOPT Version :9

Sequence 1:NP_001262608.1 Gene:CG31296 / 318668 FlyBaseID:FBgn0051296 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001102432.1 Gene:R3hdml / 366245 RGDID:1305296 Length:253 Species:Rattus norvegicus


Alignment Length:175 Identity:37/175 - (21%)
Similarity:60/175 - (34%) Gaps:40/175 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 SRLSYSMELEDLARLAVITCSTHKFCL----NSQEFYYVGTNIGSTHYLGNLNDYEDLELMLRII 151
            |.:.|.:..|.|||.|....:.   |:    .||...|||.|: |.| .|......||      :
  Rat    82 SNMEYMVWDEQLARAAEAWATQ---CIWAHGPSQLTKYVGQNL-SVH-SGRYRSVVDL------V 135

  Fly   152 QHWT---RYADYVNIK-MGVYMPTTLGKSGIAKALLLMADRNTHVGC------------SAMRFT 200
            :.|:   |:..:...| ...:.|........:....::...::.:||            |..:..
  Rat   136 KSWSEEKRHYSFPAPKDCTPHCPWLCSGPVCSHYTQMVWASSSRLGCAIHTCSSINVWGSTWQQA 200

  Fly   201 VHSVHNFVFLCAFSTDLFVERPIYRMSMRPGAACKRLDPTYSALC 245
            |:.|.|:    |...:...|.|     .:.|..|....|:|...|
  Rat   201 VYLVCNY----AIKGNWIGEAP-----YKTGKPCSACPPSYQGNC 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31296NP_001262608.1 SCP_euk 61..214 CDD:240180 30/142 (21%)
R3hdmlNP_001102432.1 SCP 65..207 CDD:294090 28/135 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.