DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31296 and Crisp2

DIOPT Version :9

Sequence 1:NP_001262608.1 Gene:CG31296 / 318668 FlyBaseID:FBgn0051296 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001011710.1 Gene:Crisp2 / 360445 RGDID:621653 Length:243 Species:Rattus norvegicus


Alignment Length:215 Identity:47/215 - (21%)
Similarity:67/215 - (31%) Gaps:61/215 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FIFVALLNFIPFGCSKLVDFCQLPYCGTNN-------LACNNPSKFSVMCPPNARTLSMSTYRNL 63
            |:|..||...|.. .|..||..|.   ||.       :|.:|..:..| .||.:..|.|      
  Rat     9 FVFAVLLPLPPTE-GKDPDFATLT---TNQIQVQREIIAKHNELRRQV-SPPGSNILKM------ 62

  Fly    64 LLIAFNEFRNYTASGKQKYLKAAAARMSRLSYSMELEDLARLAVITCSTHKFCLNSQEFYYVGTN 128
                  |:....|:..||:     |....|.:| ..||  |...|.|.         |..|:.|:
  Rat    63 ------EWNVQAAANAQKW-----ANNCILEHS-STED--RKINIKCG---------ENLYMSTD 104

  Fly   129 IGSTHYLGNLNDYEDLELMLRIIQHWTRYADYVNIKMGVYMPTTLGKSGIAKALLLMADRNTHVG 193
            ..|..               .:||.|  |.:..|...||   .....|.:.....|:...:..||
  Rat   105 PTSWR---------------TVIQSW--YEENENFVFGV---GAKPNSAVGHYTQLVWYSSFKVG 149

  Fly   194 CSAMRFTVHSVHNFVFLCAF 213
            |............:.::|.:
  Rat   150 CGVAYCPNQDTLKYFYVCHY 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31296NP_001262608.1 SCP_euk 61..214 CDD:240180 29/153 (19%)
Crisp2NP_001011710.1 CAP_CRISP 36..172 CDD:349402 36/184 (20%)
Crisp 189..243 CDD:400739
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.