DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31296 and CG10651

DIOPT Version :9

Sequence 1:NP_001262608.1 Gene:CG31296 / 318668 FlyBaseID:FBgn0051296 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster


Alignment Length:281 Identity:62/281 - (22%)
Similarity:103/281 - (36%) Gaps:51/281 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 FCQLPYCGTNNLACNNPSKFSVMCPPNARTLSMSTYRNLLLIA--FNEFRNYTASGKQKYLKAAA 87
            :|:...|...::.|::...|...||..|..:...::..:.||.  .||:||..|.|..:..|  |
  Fly    23 WCKADLCRGQHVLCDDNGNFESTCPKQAAAMVKMSWDMIALIVDKHNEYRNKFAGGMDQNPK--A 85

  Fly    88 ARMSRLSYSMELEDLARLAVITCSTHKFCLNSQEFYYVGTNIGSTHYLGNLNDY----EDLELML 148
            |||:.:.:..||..:|...|..|..      .::...:..|.|......:|..|    ...|.:.
  Fly    86 ARMTTIEWDPELAKVADGLVRRCEP------IRDQCAITPNYGHAEVSYSLEKYFCMTTKKEALR 144

  Fly   149 RIIQHW--TRYADYVNIKMGVYMPTTLGKSGIAKALL-LMADRNTHVGCSAMRFT----VHSVHN 206
            :.:.||  ....|.|   ..::...|..:..::|... ::.||...|||:.:.:.    ||.:..
  Fly   145 KQLDHWFDPNSKDEV---QKLFFSWTKNQQELSKNYFQVLRDRANRVGCAIVEYVRPALVHQLLK 206

  Fly   207 FVFLCAFSTDLFVERPIYRMSMRPGAA-C-KRLDPTYSALC------------------------ 245
            .|:.|..|.....:.|:|..:....|: | |..:..|..||                        
  Fly   207 CVYNCGVSLCEEEDNPVYEDTDEEAASECMKGSNKQYKNLCHKDELVKTCNGGSLFVEPENDYND 271

  Fly   246 AVGENYENNKPMLNARVFQLP 266
            ...||.||:.. ....||.||
  Fly   272 GQEENMENDYE-FETTVFTLP 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31296NP_001262608.1 SCP_euk 61..214 CDD:240180 38/165 (23%)
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 37/159 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.