DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31296 and CG16995

DIOPT Version :9

Sequence 1:NP_001262608.1 Gene:CG31296 / 318668 FlyBaseID:FBgn0051296 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster


Alignment Length:39 Identity:10/39 - (25%)
Similarity:15/39 - (38%) Gaps:2/39 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 FSTDLFVERPIYRMSMRPGAACKRLDPTYSALCAVGENY 251
            |..::.....:||  .:.||....|.|..:.|.....||
  Fly     6 FEQEVLQAHNLYR--AKHGAQPLTLSPKLNRLATEWANY 42

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity