DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31296 and CG9400

DIOPT Version :9

Sequence 1:NP_001262608.1 Gene:CG31296 / 318668 FlyBaseID:FBgn0051296 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster


Alignment Length:258 Identity:75/258 - (29%)
Similarity:108/258 - (41%) Gaps:31/258 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 CQLPYCGTN-----NLACNNPSKFSVMCPPNARTLSMS-TYRNLLLIAFNEFRNYTASGKQKYLK 84
            |:| |.||:     :.||.|...||..|.|..:.|.|| ..|.|||...|..|:..|||.....:
  Fly    56 CEL-YNGTHLVHVPHTACGNNGSFSPACGPEPKLLEMSERRRQLLLDMHNLARSKIASGNLDGYR 119

  Fly    85 AAAARMSRLSYSMELEDLARLAVITCS-THKFCLNSQEFYYVGTNIGSTHYLGNLNDYEDLELML 148
             :||.|..|.:..|||.:|.|....|. .|..|.|:..|.:.|.||| ..::|.........:..
  Fly   120 -SAAHMPLLRWDTELEQMAALHAKRCQFAHDKCRNTPRFKFSGQNIG-YFWIGREFKSHSRRMKS 182

  Fly   149 RIIQHWTRYADYVNIKMGVYMPTTLGKSGIAKALLLMADRNTHVGCSAMRFTVHSVHNFVFL--C 211
            .:|..:..:.|.....:..|.|...||. |....||::||...|||:.:||.....:.|.|:  |
  Fly   183 FVINWFREHQDANQSFIDRYHPHPQGKK-IGHFTLLVSDRVNRVGCAGVRFLEPKSNRFQFMLTC 246

  Fly   212 AFSTDLFVERPIYRMSMRPGAAC--KRLDPTYSALC---------------AVGENYENNKPM 257
            .:..:.....|||: |...|:.|  .|:...:.:||               ..|...:||.|:
  Fly   247 NYDYNNIFNEPIYQ-SGPAGSKCPQHRISEKFPSLCDWRDANNDLDSEESDEDGNTLDNNIPL 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31296NP_001262608.1 SCP_euk 61..214 CDD:240180 47/155 (30%)
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 47/155 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.