DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31296 and Clec18a

DIOPT Version :9

Sequence 1:NP_001262608.1 Gene:CG31296 / 318668 FlyBaseID:FBgn0051296 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_038954171.1 Gene:Clec18a / 307851 RGDID:1559899 Length:497 Species:Rattus norvegicus


Alignment Length:160 Identity:33/160 - (20%)
Similarity:60/160 - (37%) Gaps:33/160 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LLLIAFNEFRNYTASGKQKYLKAAAARMSRLSYSMELEDLARLAVITCSTHKFCLNSQEFYYVGT 127
            |:|...|..|:        .:..:||.|.|:.:|..|..||:.....|.|.           ...
  Rat    77 LILTTHNRLRS--------QVHPSAANMQRMDWSESLAQLAQARAALCGTS-----------ATP 122

  Fly   128 NIGSTHYLGNLNDYE-DLELM-------LRIIQHWTRYADYVNIKMGVYMPTTLGKSGIAKALLL 184
            |:.:|  |.|..|.. :::|:       :.::..|  :|:.:..:.|  .......:..|....|
  Rat   123 NLAAT--LRNTPDVGWNVQLLPMGSASFVEVVNVW--FAEGLQYRHG--SAECAHNATCAHYTQL 181

  Fly   185 MADRNTHVGCSAMRFTVHSVHNFVFLCAFS 214
            :...::.:||......|..|....|:||:|
  Rat   182 VWATSSQLGCGWQPCFVDQVATEAFVCAYS 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31296NP_001262608.1 SCP_euk 61..214 CDD:240180 32/158 (20%)
Clec18aXP_038954171.1 CAP_euk 77..211 CDD:349399 32/158 (20%)
CLECT 361..485 CDD:153057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.