powered by:
Protein Alignment CG31296 and CLEC18C
DIOPT Version :9
Sequence 1: | NP_001262608.1 |
Gene: | CG31296 / 318668 |
FlyBaseID: | FBgn0051296 |
Length: | 280 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_775890.2 |
Gene: | CLEC18C / 283971 |
HGNCID: | 28538 |
Length: | 446 |
Species: | Homo sapiens |
Alignment Length: | 48 |
Identity: | 15/48 - (31%) |
Similarity: | 21/48 - (43%) |
Gaps: | 8/48 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 63 LLLIAFNEFRNYTASGKQKYLKAAAARMSRLSYSMELEDLARLAVITC 110
|||...|..|: :::..||.|.||.:|..|..||:.....|
Human 50 LLLSLHNRLRS--------WVQPPAADMRRLDWSDSLAQLAQARAALC 89
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG31296 | NP_001262608.1 |
SCP_euk |
61..214 |
CDD:240180 |
15/48 (31%) |
CLEC18C | NP_775890.2 |
SCP_euk |
50..183 |
CDD:240180 |
15/48 (31%) |
CLECT |
310..434 |
CDD:153057 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1528782at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.