DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31296 and antr

DIOPT Version :9

Sequence 1:NP_001262608.1 Gene:CG31296 / 318668 FlyBaseID:FBgn0051296 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster


Alignment Length:266 Identity:67/266 - (25%)
Similarity:107/266 - (40%) Gaps:41/266 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PYCGTN-------NLACNNPSKFSVMCPPNARTLSMS-TYRNLLLIAFNEFRNYTASGKQKYLKA 85
            |:|..|       ::.|..|......|..|...|::: ..:..:|...|..|||.|||...|  :
  Fly    23 PHCKPNLCMNSEIHVGCFQPKAVGEQCGKNNLFLNVNGALKTGILSRINMLRNYVASGVGNY--S 85

  Fly    86 AAARMSRLSYSMELEDLARLAVITC-STHKFCLNSQEFYYVGT-----NIGSTHYLGN-LNDYED 143
            .||||..:.:..||:.||...|..| .|.|||.|:.:::||.|     .:|.|..|.: :.|...
  Fly    86 VAARMPTMGWDFELQRLADRQVRQCDETGKFCANTDKYHYVATTEIRSKMGRTKSLKSAILDKLL 150

  Fly   144 LELMLRIIQHWTRYADYVNIK----MGVYMPTTLGKSGIAKALLLMADRNTHVGCS-AMRFTVHS 203
            .||.|.::.........|.::    :|.|||             |:.|..:.:||. .::.....
  Fly   151 PELFLDVMGCMMNSQKLVPVREGTCVGHYMP-------------LIQDHGSRMGCGLRVKGRDEK 202

  Fly   204 VHNFVFLCAFSTDLFVERPIYRMSMRPGAACKRLDPT--YSALCAVGENYENNKPMLNARV---F 263
            ..|.:.||.||.........|.....|...| ...|:  |..||:..|..:.|..::.:.:   .
  Fly   203 ESNIILLCHFSRASVNNLVPYEEGQIPAGKC-ATGPSQMYQFLCSEDEYVDANSMVVESNMPSSD 266

  Fly   264 QLPLDL 269
            |:.:|:
  Fly   267 QIQVDI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31296NP_001262608.1 SCP_euk 61..214 CDD:240180 46/164 (28%)
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 46/164 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.