DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG31296 and Crisp2

DIOPT Version :9

Sequence 1:	NP_001262608.1	Gene:	CG31296 / 318668	FlyBaseID:	FBgn0051296	Length:	280	Species:	Drosophila melanogaster
Sequence 2:	NP_001191000.1	Gene:	Crisp2 / 22024	MGIID:	98815	Length:	243	Species:	Mus musculus

Alignment Length:	141	Identity:	30/141 - (21%)
Similarity:	45/141 - (31%)	Gaps:	52/141 - (36%)

- Green bases have known domain annotations that are detailed below.

  Fly    31 CGTNNLACNNPSKFSVMCPPNARTLSMSTYRNLLLIAFNEFRNYTASGKQKYLKAAAARMSRLSY 95
            ||.|.....:|:.:|        |:..|.|..      ||...|....|.   .:|....::|.:
Mouse    95 CGENLYMSTDPTLWS--------TVIQSWYNE------NEDFVYGVGAKP---NSAVGHYTQLVW 142

  Fly    96 SMELEDLARLAVITCSTHKFCLNSQ--EFYYV------GTNI--GSTHY---------------- 134
            ....:       |.|.. .:|.|..  :::||      |.|:  .||.|
Mouse   143 YSSFK-------IGCGI-AYCPNQDNLKYFYVCHYCPMGNNVMKKSTPYQQGTPCASCPNNCENG 199

  Fly   135 -LGNLNDYEDL 144
             ..|..|:|||
Mouse   200 LCTNSCDFEDL 210

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG31296	NP_001262608.1	SCP_euk	61..214	CDD:240180	22/111 (20%)
Crisp2	NP_001191000.1	SCP_CRISP	36..171	CDD:240183	20/100 (20%)
Crisp2	NP_001191000.1	Crisp	189..243	CDD:285731	5/22 (23%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG2340
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1528782at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	3	2.820