DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31296 and scl-27

DIOPT Version :9

Sequence 1:NP_001262608.1 Gene:CG31296 / 318668 FlyBaseID:FBgn0051296 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_503189.2 Gene:scl-27 / 191204 WormBaseID:WBGene00022638 Length:200 Species:Caenorhabditis elegans


Alignment Length:218 Identity:45/218 - (20%)
Similarity:73/218 - (33%) Gaps:72/218 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 NEFRNYTASGKQK----YLKAAAARMSRLSYSMELEDLARLAVITCSTHKFCLNSQEFY----YV 125
            ||..|..|.||.:    |.||:...|.:.:.|        ||....:....|...:|.|    ..
 Worm    32 NELGNDVACGKYQNHSDYPKASQMMMMKWNQS--------LAEAVGNVKHSCQQLKERYLKKFIK 88

  Fly   126 GTNIGSTHYLGNLND--YEDLELMLRIIQHWTRYADYVNIKMGVYMPTTLGKSGIAKALLLMADR 188
            |.|:...::...:.|  .|..|::.|..:..:..|::                .:.:...::.|:
 Worm    89 GENLYRVYFYNTVVDGLQERDEILRRSEKAVSTGANF----------------EVERFHKILHDK 137

  Fly   189 NTHVGCS----------AMRFTVHSVHNFVFLCAFSTDLFVERPIYRMSM-RPGAACKRLDPTYS 242
            .|.:|||          .||:         |:|.:|       ||....| ..|..|.:      
 Worm   138 VTSIGCSYKNCENDQGYDMRY---------FICKYS-------PIDNGDMYHVGEPCSQ------ 180

  Fly   243 ALCAVGENYENNKPMLNARVFQL 265
              |.||.:...|   .|:..|.|
 Worm   181 --CPVGTSCNQN---ANSEFFNL 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31296NP_001262608.1 SCP_euk 61..214 CDD:240180 32/164 (20%)
scl-27NP_503189.2 CAP_euk 27..164 CDD:349399 32/164 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.