DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31296 and scl-21

DIOPT Version :9

Sequence 1:NP_001262608.1 Gene:CG31296 / 318668 FlyBaseID:FBgn0051296 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_507793.1 Gene:scl-21 / 189870 WormBaseID:WBGene00012816 Length:198 Species:Caenorhabditis elegans


Alignment Length:208 Identity:37/208 - (17%)
Similarity:65/208 - (31%) Gaps:75/208 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 PPNARTLSMSTYRNLLLIAFNEFRNYTASGKQKYLKAAAARMSRLSYSMELEDLARLAVITCSTH 113
            ||.:..|.| |:.:.|.:|           .||..|.....:...|..:..:.:....|:|.:.:
 Worm    53 PPASDMLKM-TWNSTLAVA-----------AQKLAKTCFIAVESSSPGIADKRIVAANVVTVAKN 105

  Fly   114 -----KFCLNSQEFYYVGTNIGSTHYLGNLNDYEDLELMLRIIQHWTRYADYVNIKMGVYMPTTL 173
                 |..||.:               .||..|.               ::|:.|:         
 Worm   106 ALGHWKHSLNKE---------------WNLKSYN---------------SNYIGIQ--------- 131

  Fly   174 GKSGIAKALLLMADRNTHVGCSAMRFTVHSVHN--FVFLCAFSTDLFVER-PIYRMSMRPGAACK 235
                      |:..:::.|||......:.|...  :..:|:|.....:.| |:|    :.|.||:
 Worm   132 ----------LIWAKSSSVGCGFSPCEIDSQGRRWYKVVCSFEKKGGITREPVY----KKGKACE 182

  Fly   236 RLDPTYSALCAVG 248
            ....  ...||.|
 Worm   183 ACPA--GTKCASG 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31296NP_001262608.1 SCP_euk 61..214 CDD:240180 22/159 (14%)
scl-21NP_507793.1 CAP_euk 23..163 CDD:349399 27/170 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.