Sequence 1: | NP_001262608.1 | Gene: | CG31296 / 318668 | FlyBaseID: | FBgn0051296 | Length: | 280 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_500349.1 | Gene: | F58E2.5 / 186521 | WormBaseID: | WBGene00019049 | Length: | 232 | Species: | Caenorhabditis elegans |
Alignment Length: | 205 | Identity: | 41/205 - (20%) |
---|---|---|---|
Similarity: | 77/205 - (37%) | Gaps: | 65/205 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 64 LLIAFNEFRNYTASG----KQKYLK-----AAAARMSRLSYSMELEDLARLAVITCSTH------ 113
Fly 114 --KFCLNSQEFYYVGTNIGSTHYLGNLND-----YEDLELMLRIIQHWTRYADYVNIKMGVYMPT 171
Fly 172 TLGKSGIAKALLLMADRNTHVGCSAMRFTVHSVHNFVFLCAFSTDLF--VERPIYRMSMRPGAAC 234
Fly 235 KRLD---PTY 241 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31296 | NP_001262608.1 | SCP_euk | 61..214 | CDD:240180 | 33/171 (19%) |
F58E2.5 | NP_500349.1 | CAP_euk | 40..177 | CDD:349399 | 33/170 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2340 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1528782at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |