DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31296 and F58E2.5

DIOPT Version :9

Sequence 1:NP_001262608.1 Gene:CG31296 / 318668 FlyBaseID:FBgn0051296 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_500349.1 Gene:F58E2.5 / 186521 WormBaseID:WBGene00019049 Length:232 Species:Caenorhabditis elegans


Alignment Length:205 Identity:41/205 - (20%)
Similarity:77/205 - (37%) Gaps:65/205 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 LLIAFNEFRNYTASG----KQKYLK-----AAAARMSRLSYSMELEDLARLAVITCSTH------ 113
            :|.|:|..|:..|:|    |.::..     |.||.|.:|.::..|..||:..|.:|.::      
 Worm    43 ILNAYNNLRSEIANGTFTMKLQFPDITIPLAPAAGMLKLKWNCRLAALAQAYVDSCPSYQDLRVH 107

  Fly   114 --KFCLNSQEFYYVGTNIGSTHYLGNLND-----YEDLELMLRIIQHWTRYADYVNIKMGVYMPT 171
              ||.:.   :.::..|:..     ::.|     ::.||:..|        ..|:|         
 Worm   108 KPKFPVT---YSFLDANLQE-----HIKDPVLYRFKILEMDFR--------RGYIN--------- 147

  Fly   172 TLGKSGIAKALLLMADRNTHVGCSAMRFTVHSVHNFVFLCAFSTDLF--VERPIYRMSMRPGAAC 234
                ....|.|:    .:..:||:....:    .|.:|:|.:...::  .:.|: .....||...
 Worm   148 ----DDWFKKLI----SSKSIGCAFNNCS----ENVLFVCYYKEQIYEDFKFPV-NGGAEPGRFI 199

  Fly   235 KRLD---PTY 241
            |.||   |.|
 Worm   200 KELDDYVPRY 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31296NP_001262608.1 SCP_euk 61..214 CDD:240180 33/171 (19%)
F58E2.5NP_500349.1 CAP_euk 40..177 CDD:349399 33/170 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.