DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31296 and F57B7.2

DIOPT Version :9

Sequence 1:NP_001262608.1 Gene:CG31296 / 318668 FlyBaseID:FBgn0051296 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001367203.1 Gene:F57B7.2 / 186438 WormBaseID:WBGene00010192 Length:330 Species:Caenorhabditis elegans


Alignment Length:106 Identity:25/106 - (23%)
Similarity:37/106 - (34%) Gaps:18/106 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LSMSTYRNLLLIAFNEFRNYTASGKQKYLKAAAARMSRLSYSMELEDLARLAVITCSTHKFCLNS 119
            ||...::...|.|.||.|       |:|      ....|.:|.||.::|....:     |.....
 Worm   149 LSEVNFQRSCLDAHNECR-------QRY------GNENLCWSTELAEMAHAWAV-----KLADRG 195

  Fly   120 QEFYYVGTNIGSTHYLGNLNDYEDLELMLRIIQHWTRYADY 160
            :..|.....||....|...|:...|.....:||.|.:.|.:
 Worm   196 RVLYPELPGIGENLILKEANEQSHLPTGQEVIQEWEKEAQF 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31296NP_001262608.1 SCP_euk 61..214 CDD:240180 23/100 (23%)
F57B7.2NP_001367203.1 CAP_GAPR1-like 153..286 CDD:349401 23/102 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.