DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31296 and vap-1

DIOPT Version :9

Sequence 1:NP_001262608.1 Gene:CG31296 / 318668 FlyBaseID:FBgn0051296 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001024553.1 Gene:vap-1 / 181768 WormBaseID:WBGene00006886 Length:424 Species:Caenorhabditis elegans


Alignment Length:217 Identity:46/217 - (21%)
Similarity:79/217 - (36%) Gaps:36/217 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 MCPPNARTLSMSTYRNLLLIAFNEFRNYTASGKQKYLKAAAA------RMSRLSYSMELEDLARL 105
            |||  :.|......|...|...|:.|...|.|.:....||.|      :|.:|.||..:|..|| 
 Worm   224 MCP--SVTDQSDQARQNFLDTHNKLRTSLAKGLEADGIAAGAFAPMAKQMPKLKYSCTVEANAR- 285

  Fly   106 AVITCSTHKFCLNSQEFYYVGTNIGSTHYLGNLNDYEDLELMLRIIQ-HWTRYADYVNIKMGVYM 169
                 :..|.||...........:|...|:.::|:...::......: .|:...|:     ||..
 Worm   286 -----TWAKGCLYQHSTSAQRPGLGENLYMISINNMPKIQTAEDSSKAWWSELKDF-----GVGS 340

  Fly   170 PTTLGKS----GIAKALLLMADRNTHVGCSAMRFTVHSVHNFVF-LCAFS-TDLFVERPIYRMSM 228
            ...|.::    |:.....:..:..|.:||     .|.:...|.: :|.:. ...::.:.||    
 Worm   341 DNILTQAVFDRGVGHYTQMAWEGTTEIGC-----FVENCPTFTYSVCQYGPAGNYMNQLIY---- 396

  Fly   229 RPGAACKR-LDPTYSALCAVGE 249
            ..|:.|.. .|...:..|:|.|
 Worm   397 TKGSPCTADADCPGTQTCSVAE 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31296NP_001262608.1 SCP_euk 61..214 CDD:240180 34/164 (21%)
vap-1NP_001024553.1 SCP 31..175 CDD:214553
SCP 234..386 CDD:214553 34/167 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.