DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31296 and scl-13

DIOPT Version :9

Sequence 1:NP_001262608.1 Gene:CG31296 / 318668 FlyBaseID:FBgn0051296 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_504055.1 Gene:scl-13 / 178798 WormBaseID:WBGene00019179 Length:208 Species:Caenorhabditis elegans


Alignment Length:230 Identity:42/230 - (18%)
Similarity:79/230 - (34%) Gaps:82/230 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 STYRNLLLIAFNEFR------NYTASGKQKYLKAAAARMSRLSYSMELEDLARLAVITCSTHKFC 116
            ||.:..::.|.|:.|      :|.|:|.|   :.:|:.|.::.:.   |.:|..|          
 Worm    20 STAQGQIVDAHNKLRSAIAQGSYVAAGTQ---EPSASNMRKIVWD---ETVAAAA---------- 68

  Fly   117 LNSQEFY------YVGTNIGSTHYLGNLNDYEDLELMLRIIQHWTRYADYVNIKMGV-------- 167
               ||:.      :.||:.|...|..                 |:..|.....|.||        
 Worm    69 ---QEYAEGCPDDHSGTSYGENLYWS-----------------WSSSAPSSLDKFGVAASNSWES 113

  Fly   168 ------YMPTTLGKSGIAKAL-----LLMADRNTHVGCSAMR----FTVHSVHNFVFLCAF-STD 216
                  :..|.|.::|.|..:     :..|: .:.:||....    ....:::....:|.: |..
 Worm   114 EFQKYGWTSTFLDEAGFATGIGHATQMAWAE-TSKIGCGIKNCGKDANKKNMYKVAVVCQYDSAG 177

  Fly   217 LFVERPIYRM-----SMRPGAACKRLDPTYSALCA 246
            ..::..||:.     :....|:|::    .|.|||
 Worm   178 NMMDSDIYQQGETCSACSEDASCEQ----DSGLCA 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31296NP_001262608.1 SCP_euk 61..214 CDD:240180 31/188 (16%)
scl-13NP_504055.1 SCP 21..174 CDD:214553 32/189 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.