Sequence 1: | NP_001262608.1 | Gene: | CG31296 / 318668 | FlyBaseID: | FBgn0051296 | Length: | 280 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_502506.1 | Gene: | scl-5 / 178253 | WormBaseID: | WBGene00008027 | Length: | 208 | Species: | Caenorhabditis elegans |
Alignment Length: | 207 | Identity: | 38/207 - (18%) |
---|---|---|---|
Similarity: | 64/207 - (30%) | Gaps: | 50/207 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 64 LLIAFNEFRN------YTASGKQKYLKAAAARMSRLSYSMELEDLARLAVITCST-HKFCLNSQE 121
Fly 122 ---FYYVG---TNI------GSTHYLGNLNDYEDLELMLRIIQHWTRYADYVNIKMGVYMPTTLG 174
Fly 175 KSGIAKALLLMADRNTHVGCSAMRF--TVHSVHNFVFLCAFSTD-LFVERPIYRMSMRPGAACKR 236
Fly 237 LDPTYSALCAVG 248 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31296 | NP_001262608.1 | SCP_euk | 61..214 | CDD:240180 | 31/170 (18%) |
scl-5 | NP_502506.1 | SCP | 22..175 | CDD:214553 | 31/171 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 41 | 1.000 | Domainoid score | I8510 |
eggNOG | 1 | 0.900 | - | - | E1_COG2340 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 71 | 1.000 | Inparanoid score | I3895 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1528782at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10334 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.970 |