DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31296 and lon-1

DIOPT Version :9

Sequence 1:NP_001262608.1 Gene:CG31296 / 318668 FlyBaseID:FBgn0051296 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_498166.1 Gene:lon-1 / 175753 WormBaseID:WBGene00003055 Length:312 Species:Caenorhabditis elegans


Alignment Length:242 Identity:52/242 - (21%)
Similarity:82/242 - (33%) Gaps:69/242 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PSKFSVMCPPNARTLSMSTYRNLLLIAFNEFRNYTASGKQKYLK-AAAARMSRLSYSMELEDLAR 104
            ||.|.    .::..||.|.:.|..|      :.:......:|.: ..|:.|:.|.:|.||...|:
 Worm    60 PSHFQ----SDSGLLSRSEHPNEYL------KKWITHEHNRYRRMVPASDMNMLYWSDELAASAQ 114

  Fly   105 LAVITCSTHKFCLNSQEFYYVGTNIGSTHYLGNLNDYEDLELMLRIIQHWTRYADYVNIKMGV-- 167
            ....||...    :|:....||.||.:..|    ::|.|      .|..|  :.:..|.:.|.  
 Worm   115 RHADTCDFR----HSRGRINVGENIWAAPY----SNYSD------AISIW--FNEVHNPRCGCNH 163

  Fly   168 --------YMPTTLGKSGIAKALLLMADRNTHVGCSAMRF-TVHSV----HNFVFLCAFS---TD 216
                    |:.....|:.:             |||...|. .|..|    |..||:|.::   ..
 Worm   164 AYKHCCGHYVQVVWAKTNL-------------VGCGFSRCRDVQGVWGRGHRNVFVCHYNPQGNT 215

  Fly   217 LFV-------ERPIYRMSMRPGAACKRLDPT----YSALCAVGENYE 252
            :||       ..|.:..:......|......    |..||.:.:|||
 Worm   216 VFVTARGQLYAMPAFTWASGDNGKCSNCPANAPACYQGLCYMPKNYE 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31296NP_001262608.1 SCP_euk 61..214 CDD:240180 36/168 (21%)
lon-1NP_498166.1 SCP 81..211 CDD:214553 34/158 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.