DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31296 and CG43777

DIOPT Version :9

Sequence 1:NP_001262608.1 Gene:CG31296 / 318668 FlyBaseID:FBgn0051296 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001261163.1 Gene:CG43777 / 14462631 FlyBaseID:FBgn0264299 Length:273 Species:Drosophila melanogaster


Alignment Length:286 Identity:55/286 - (19%)
Similarity:80/286 - (27%) Gaps:119/286 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 YCGTNNLAC------------------NNPSKFSVMCPPNARTLSMSTYRNLLLIAFNEFRNYTA 76
            ||......|                  .|.:||....|.|.|      .:.:.|...|..||..|
  Fly    21 YCNNKTHKCVLEKKKHFMCHLKDFTVYGNSTKFHASVPNNMR------MQKIALDILNNLRNKFA 79

  Fly    77 SG----KQKYLKAAAARMSRLSYSMELEDLARLAVITCSTHKF-CLNSQEFYYVGTNIGSTHYLG 136
            .|    |.....|.|.||.:|.:..||..:......|.|.... |.::..|.:||..|.......
  Fly    80 GGELRTKGNKTFAKARRMRQLFWDKELAYMGNNHASTLSLKSSQCRSTLRFPHVGEAIALVTPRE 144

  Fly   137 NLN--------------DYE---DLELMLRI--------IQHWTRYADYVNIKMGVYMPTTLGKS 176
            .||              :|:   |.:.:|..        ::|:|.                    
  Fly   145 KLNLKEIYSKAFTPMFAEYQHVSDPDALLHAFDPDRDFQVRHFTN-------------------- 189

  Fly   177 GIAKALLLMADRNTHVGCS---------AMRFTVHSVHNFVFLCAFSTDLFVERPIYRMSMRPGA 232
                   :::||.:.|||.         :::|           |.|.|..|...     :|....
  Fly   190 -------IISDRVSRVGCGVAVGANCNPSIKF-----------CHFLTCYFDFH-----NMAGSY 231

  Fly   233 ACKRLDPT-------------YSALC 245
            ..|..|||             |:.||
  Fly   232 VYKAGDPTSSCDDWGVVSSDKYANLC 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31296NP_001262608.1 SCP_euk 61..214 CDD:240180 35/191 (18%)
CG43777NP_001261163.1 SCP_euk 64..223 CDD:240180 37/196 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.