DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31296 and GLIPR1

DIOPT Version :9

Sequence 1:NP_001262608.1 Gene:CG31296 / 318668 FlyBaseID:FBgn0051296 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_006842.2 Gene:GLIPR1 / 11010 HGNCID:17001 Length:266 Species:Homo sapiens


Alignment Length:131 Identity:28/131 - (21%)
Similarity:50/131 - (38%) Gaps:36/131 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 NEFRNYTASGKQKYLKAAAARMSRLSYSMELEDLARLAVITCS---------THKFCLNSQEFYY 124
            |:||:        .:|..|:.|..:::...|..:|:.....|.         .||...|   |..
Human    42 NKFRS--------EVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPN---FTS 95

  Fly   125 VGTNI--GS----------THYLGNLNDYE-DLELMLRIIQHWTR--YADYVNIKMGV-YMPTTL 173
            :|.||  ||          |::...:.||: ...:..::..|:|:  :||...:...| :.|...
Human    96 LGENIWTGSVPIFSVSSAITNWYDEIQDYDFKTRICKKVCGHYTQVVWADSYKVGCAVQFCPKVS 160

  Fly   174 G 174
            |
Human   161 G 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31296NP_001262608.1 SCP_euk 61..214 CDD:240180 28/131 (21%)
GLIPR1NP_006842.2 SCP_GLIPR-1_like 32..178 CDD:240185 28/131 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.