DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31296 and serotriflin

DIOPT Version :10

Sequence 1:NP_732044.2 Gene:CG31296 / 318668 FlyBaseID:FBgn0051296 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_017949574.2 Gene:serotriflin / 101732829 XenbaseID:XB-GENE-29209244 Length:290 Species:Xenopus tropicalis


Alignment Length:167 Identity:30/167 - (17%)
Similarity:63/167 - (37%) Gaps:49/167 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   537 FIKKMPKGYDTQIGDGGVQLSGGQKQRVAIARTLIRDPKVLLLDEATSAL----------DAQSE 591
            ||:.:...|           .|..:.::::.|.|  :.:||.:|:....|          |....
 Frog    25 FIENLESDY-----------FGKLESKLSVIRNL--NDQVLFIDQGNRPLFEDMTDSDCRDNAPR 76

  Fly   592 SVVQSALNNASKGR---TTIMI-AHRLSTIREADK-------------------IVFFEKGVIVE 633
            ::...::...|:.|   .||.: ..::||:...:|                   |:||::.|   
 Frog    77 TIFIISMYKDSQPRGMAVTISVKCEKISTLSCENKIISFKEMNPPDNIKDTKSDIIFFQRSV--- 138

  Fly   634 AGNHEELVNLGGRYFDLVKAQAFKQDPDEIALEKEEE 670
            .|:..::......|.....|...::|..::.|:||:|
 Frog   139 PGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDE 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31296NP_732044.2 CAP_euk 61..214 CDD:349399
serotriflinXP_017949574.2 CAP 80..217 CDD:412178 19/99 (19%)
Crisp 234..289 CDD:462519
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.