DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31296 and LOC100536500

DIOPT Version :9

Sequence 1:NP_001262608.1 Gene:CG31296 / 318668 FlyBaseID:FBgn0051296 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_017207056.1 Gene:LOC100536500 / 100536500 -ID:- Length:245 Species:Danio rerio


Alignment Length:145 Identity:28/145 - (19%)
Similarity:56/145 - (38%) Gaps:39/145 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SVMCPPNARTLSMSTYRNLLLIAFNEFRNYTASGKQKYLKAAAARMSRLSYSMELEDLARLAVIT 109
            |..|........:|:.:..::...|.||        :.::.:|:.|.::|:|..:.:.||..:..
Zfish    24 SAACSVTGVCTELSSVQQEIVDVHNAFR--------RAVQPSASNMLKMSWSDAVAESARGWINK 80

  Fly   110 CS-TH----KFCLNSQEF---YYVGTNIGS------------THY---LGNLNDYEDLELMLRII 151
            |: ||    ...||..|.   .:..|.|.|            .:|   :|::|.        :..
Zfish    81 CNMTHGPPSSRMLNGYEMGENLFKATGISSWTSVVDAWHSEVNNYKYPIGSING--------QAT 137

  Fly   152 QHWTRYADYVNIKMG 166
            .|:|:...|.:.::|
Zfish   138 GHYTQVVWYSSYEVG 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31296NP_001262608.1 SCP_euk 61..214 CDD:240180 25/129 (19%)
LOC100536500XP_017207056.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.