DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31296 and crispld2

DIOPT Version :9

Sequence 1:NP_001262608.1 Gene:CG31296 / 318668 FlyBaseID:FBgn0051296 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_003199065.1 Gene:crispld2 / 100535149 ZFINID:ZDB-GENE-130131-1 Length:508 Species:Danio rerio


Alignment Length:135 Identity:30/135 - (22%)
Similarity:43/135 - (31%) Gaps:44/135 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 ELMLRIIQ----HWTRY--------ADYVNIKMGVY---------MPTTLGKSGIAKALLLMADR 188
            :|::.|.|    ||.||        |.|..:|...|         .|.............|:...
Zfish   110 DLLMSIGQNLAVHWGRYRSPAYHVQAWYDEVKDYTYPYPHECNPWCPERCSGPMCTHYTQLVWAT 174

  Fly   189 NTHVGCSAMRFTVHSV----------HNFVFL-CAFST--DLFVERPIYRMSMRPGAACKRLDPT 240
            ...|||:     ||..          .|.|:| |.:|.  :...|.|     .:.|..|.:..|:
Zfish   175 TNRVGCA-----VHVCPRMNVWGEIWENAVYLVCNYSPKGNWIGEAP-----YQHGRPCSQCPPS 229

  Fly   241 YSALC 245
            |..:|
Zfish   230 YGGVC 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31296NP_001262608.1 SCP_euk 61..214 CDD:240180 22/100 (22%)
crispld2XP_003199065.1 SCP_euk 61..206 CDD:240180 22/100 (22%)
LCCL 299..382 CDD:128866
LCCL 402..495 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.