powered by:
Protein Alignment CG31296 and crisp2-like
DIOPT Version :9
Sequence 1: | NP_001262608.1 |
Gene: | CG31296 / 318668 |
FlyBaseID: | FBgn0051296 |
Length: | 280 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001188271.2 |
Gene: | crisp2-like / 100495843 |
-ID: | - |
Length: | 207 |
Species: | Xenopus tropicalis |
Alignment Length: | 46 |
Identity: | 9/46 - (19%) |
Similarity: | 22/46 - (47%) |
Gaps: | 13/46 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 FVALLNFIPFGCSKLVDFCQLPY-----CGT------NNLACNNPS 42
:|::.::.|.| .:::..:.|| |.: :.|..:||:
Frog 163 YVSICHYCPMG--NMINSIKTPYEAGEWCASCPESCEDKLCTSNPT 206
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG31296 | NP_001262608.1 |
SCP_euk |
61..214 |
CDD:240180 |
|
crisp2-like | NP_001188271.2 |
SCP |
33..171 |
CDD:320774 |
1/7 (14%) |
Crisp |
189..>205 |
CDD:312162 |
2/15 (13%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1528782at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.