DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31296 and pi15

DIOPT Version :9

Sequence 1:NP_001262608.1 Gene:CG31296 / 318668 FlyBaseID:FBgn0051296 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_002937120.1 Gene:pi15 / 100489915 XenbaseID:XB-GENE-989406 Length:258 Species:Xenopus tropicalis


Alignment Length:280 Identity:58/280 - (20%)
Similarity:100/280 - (35%) Gaps:82/280 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FGCSKLVDFCQLPYCGTNNLACNNPSKFSVMCP-----------PNARTLSMSTYRNLLLIAFNE 70
            |..|.|.:.|.|....:::|| :..|.::::.|           |.||.....:..:  :||..|
 Frog    11 FLLSLLCETCGLVLPKSSDLA-SAASNYTIIKPDLSARLDAAKVPKARRKRYISQND--MIAIVE 72

  Fly    71 FRNYTASGKQKYLKAAAARMSRLSYSMELEDLARLAVITCSTHKFCL----NSQEFYYVGTNIGS 131
            :.|..   :.|....||    .:.|.:..|:||:||....:|   |:    .|....::|.|:..
 Frog    73 YHNQV---RGKVFPPAA----NMEYMVWDENLAKLAEAWAAT---CIWDHGPSYLLKFLGQNLSV 127

  Fly   132 THYLGNLNDYEDLELMLRIIQHW-TRYADYV---------NIKMGVYMPTTLGKSGIAKALLLMA 186
                 ....|:.:   |::::.| ....||.         ...:..|.|.....:.:..|     
 Frog   128 -----RTGRYKSI---LQLVKPWYDEVKDYAFPYPQECNPRCPLRCYGPMCTHYTQMVWA----- 179

  Fly   187 DRNTHVGCSAMRFTVHSVHNF----------VFL-CAFST--DLFVERPIYRMSMRPGAACKRLD 238
             ....:||:     :|:.||.          |:| |.:|.  :...|.| |.:    |..|....
 Frog   180 -TTNRIGCA-----IHTCHNMNVWGAVWRRAVYLVCNYSPKGNWIGEAP-YTI----GVPCSACP 233

  Fly   239 PTYSALCA-------VGENY 251
            |:|...|:       |..||
 Frog   234 PSYGGSCSDNQCFPGVTSNY 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31296NP_001262608.1 SCP_euk 61..214 CDD:240180 34/177 (19%)
pi15XP_002937120.1 CAP_PI15 67..212 CDD:349408 34/173 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.