powered by:
Protein Alignment CG31296 and glipr2
DIOPT Version :9
Sequence 1: | NP_001262608.1 |
Gene: | CG31296 / 318668 |
FlyBaseID: | FBgn0051296 |
Length: | 280 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001107504.1 |
Gene: | glipr2 / 100135358 |
XenbaseID: | XB-GENE-5758336 |
Length: | 441 |
Species: | Xenopus tropicalis |
Alignment Length: | 66 |
Identity: | 17/66 - (25%) |
Similarity: | 29/66 - (43%) |
Gaps: | 9/66 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 NFIPFGCSKLVDFCQLPYCGTNNLACNNPSKFSVMCPPNARTLSMSTYRNLLLIAFNEFRNYTAS 77
|.:|.| ||:.| ..|..:....:||..:|:..|.. .:.::|..||...|::|....:
Frog 258 NVLPRG-SKVTD-----DGGDEDGFVKSPSSTAVLPIPEK---ELKSFRKDLLSEHNQYRKLHGA 313
Fly 78 G 78
|
Frog 314 G 314
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1528782at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.